BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030731E7_C07_e627_05.seq (1563 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB023025-1|BAA74592.1| 133|Apis mellifera actin protein. 279 6e-77 AJ276511-1|CAC06383.1| 352|Apis mellifera Antennapedia protein ... 25 1.3 DQ232888-1|ABB36783.1| 499|Apis mellifera cytochrome P450 monoo... 25 1.8 >AB023025-1|BAA74592.1| 133|Apis mellifera actin protein. Length = 133 Score = 279 bits (683), Expect = 6e-77 Identities = 132/133 (99%), Positives = 133/133 (100%) Frame = +2 Query: 404 EMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKC 583 EMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKC Sbjct: 1 EMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKC 60 Query: 584 DVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSI 763 DVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPE+KYSVWIGGSI Sbjct: 61 DVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPEKKYSVWIGGSI 120 Query: 764 LASLSTFQQMWIS 802 LASLSTFQQMWIS Sbjct: 121 LASLSTFQQMWIS 133 >AJ276511-1|CAC06383.1| 352|Apis mellifera Antennapedia protein protein. Length = 352 Score = 25.4 bits (53), Expect = 1.3 Identities = 8/19 (42%), Positives = 15/19 (78%) Frame = +3 Query: 672 RKSQPSLHPR*RSKSSRHQ 728 ++SQP +HPR + ++ +HQ Sbjct: 215 QQSQPGMHPRQQQQAQQHQ 233 >DQ232888-1|ABB36783.1| 499|Apis mellifera cytochrome P450 monooxygenase protein. Length = 499 Score = 25.0 bits (52), Expect = 1.8 Identities = 21/62 (33%), Positives = 30/62 (48%) Frame = +2 Query: 566 NSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSV 745 N +K D DI++ Y + V MYP + M+K I+ + KI I P E K + Sbjct: 342 NKELKYD-DIKEMEYLDKVFKETLRMYPPASILMRKAISDYTFNDTKITI--PKEMK--I 396 Query: 746 WI 751 WI Sbjct: 397 WI 398 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 332,997 Number of Sequences: 438 Number of extensions: 6736 Number of successful extensions: 10 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 146,343 effective HSP length: 61 effective length of database: 119,625 effective search space used: 54907875 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -