BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030731E7_C06_e619_06.seq (1521 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_10137| Best HMM Match : No HMM Matches (HMM E-Value=.) 173 3e-43 >SB_10137| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 173 bits (421), Expect = 3e-43 Identities = 80/121 (66%), Positives = 96/121 (79%) Frame = +3 Query: 90 KRGDERFIRHQSDRYDKLKRNWRKPRGIDNRVRRRFKGQYLMPNIGYGSNKKTRHMLPSG 269 K+ ++FIRHQSDRY ++ +WRKP+GIDNRVRRRFKGQYLMPNIGYGSNKKTR ++P G Sbjct: 12 KKRQKKFIRHQSDRYMRVGESWRKPKGIDNRVRRRFKGQYLMPNIGYGSNKKTRFLMPDG 71 Query: 270 FRKVLVHNVRELEILMMQNRXYCAEIXHGSSXXKNRKAXXERAXXLXIRXTNAAARLRSX 449 F+K +VHNV+ELE+LMM NR Y AEI H S K RKA ERA L I+ TN+ ARLRS Sbjct: 72 FKKFVVHNVKELEVLMMMNRSYAAEIAHNVSSRK-RKAIVERAQQLSIKVTNSNARLRSE 130 Query: 450 D 452 + Sbjct: 131 E 131 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,295,413 Number of Sequences: 59808 Number of extensions: 215196 Number of successful extensions: 532 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 517 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 531 length of database: 16,821,457 effective HSP length: 85 effective length of database: 11,737,777 effective search space used: 4941604117 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -