BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030731E7_C02_e587_06.seq (1511 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value M93689-2|AAA29367.1| 975|Anopheles gambiae protein ( Anopheles ... 25 7.6 AB090821-2|BAC57918.1| 1168|Anopheles gambiae reverse transcript... 24 10.0 >M93689-2|AAA29367.1| 975|Anopheles gambiae protein ( Anopheles gambiae T1 retroposon. ). Length = 975 Score = 24.6 bits (51), Expect = 7.6 Identities = 10/27 (37%), Positives = 16/27 (59%) Frame = -1 Query: 215 RLEDLHQLQRPYAFHRRYGACAHPPLQ 135 R+E + +L AF R +GA + PP + Sbjct: 846 RIESIQRLFTRVAFRRLFGAASLPPYE 872 >AB090821-2|BAC57918.1| 1168|Anopheles gambiae reverse transcriptase protein. Length = 1168 Score = 24.2 bits (50), Expect = 10.0 Identities = 14/45 (31%), Positives = 25/45 (55%) Frame = -3 Query: 513 RILDARLGPRRRGTSPSVSPGISCAPLRTMTRAKTERLASTMQPR 379 RI+DA P + G + APLR++ + +++A++M PR Sbjct: 394 RIVDALFPVHPPVEWPDLGVG-NMAPLRSIGLTELDQIAASMHPR 437 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,121,735 Number of Sequences: 2352 Number of extensions: 20303 Number of successful extensions: 25 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 25 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 25 length of database: 563,979 effective HSP length: 67 effective length of database: 406,395 effective search space used: 177188220 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -