BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030731E7_B12_e666_04.seq (1475 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292360-1|CAL23172.2| 427|Tribolium castaneum gustatory recept... 24 3.3 AM292331-1|CAL23143.2| 437|Tribolium castaneum gustatory recept... 24 3.3 AM292382-1|CAL23194.2| 670|Tribolium castaneum gustatory recept... 23 4.3 AM292379-1|CAL23191.2| 376|Tribolium castaneum gustatory recept... 23 7.6 AM292348-1|CAL23160.2| 346|Tribolium castaneum gustatory recept... 23 7.6 >AM292360-1|CAL23172.2| 427|Tribolium castaneum gustatory receptor candidate 39 protein. Length = 427 Score = 23.8 bits (49), Expect = 3.3 Identities = 11/33 (33%), Positives = 15/33 (45%) Frame = +3 Query: 891 WYXDCXAXGTXACGXGKPLLKSXXTRGPNXXLG 989 W+ +C A G A L K+ +R P LG Sbjct: 225 WFINCTAKGRVAVWMCNNLHKALESRNPAKILG 257 >AM292331-1|CAL23143.2| 437|Tribolium castaneum gustatory receptor candidate 10 protein. Length = 437 Score = 23.8 bits (49), Expect = 3.3 Identities = 11/33 (33%), Positives = 15/33 (45%) Frame = +3 Query: 891 WYXDCXAXGTXACGXGKPLLKSXXTRGPNXXLG 989 W+ +C A G A L K+ +R P LG Sbjct: 225 WFINCTAKGRVAVWMCNNLHKALESRNPAKILG 257 >AM292382-1|CAL23194.2| 670|Tribolium castaneum gustatory receptor candidate 61 protein. Length = 670 Score = 23.4 bits (48), Expect = 4.3 Identities = 21/86 (24%), Positives = 39/86 (45%), Gaps = 11/86 (12%) Frame = +2 Query: 188 YDLLIIINYFQILRGPF-----------IYNTHKFFCSYV*LNVSFYF*LSRNIIVVPII 334 Y+ L I Y +L GP + T+K+ C+++ + FY ++ V+ + Sbjct: 287 YNTLFFIVYVSLLLGPHPTYFGKTGRKTVLKTNKY-CNFI---ILFYL----SVFVILVY 338 Query: 335 FRNYKQMVQR*THKALYNRNSFTNLL 412 + + + T+ LYN N+F LL Sbjct: 339 YASLDETPNPVTNGKLYNFNTFAKLL 364 >AM292379-1|CAL23191.2| 376|Tribolium castaneum gustatory receptor candidate 58 protein. Length = 376 Score = 22.6 bits (46), Expect = 7.6 Identities = 11/38 (28%), Positives = 18/38 (47%) Frame = -3 Query: 426 LSFSCNKFVKEFLLYNALCVHLCTICL*FRNIIGTTMI 313 LS + N + F++ + C + IC I+GT I Sbjct: 23 LSITPNYDFENFVIISPRCDKISAICFLLSTILGTCWI 60 >AM292348-1|CAL23160.2| 346|Tribolium castaneum gustatory receptor candidate 27 protein. Length = 346 Score = 22.6 bits (46), Expect = 7.6 Identities = 13/29 (44%), Positives = 15/29 (51%) Frame = -1 Query: 446 TFFLKKFLVFHVINS*KNFYYTMPYVFTF 360 TFFLK V+HV N Y VF+F Sbjct: 14 TFFLKALTVWHVENPTYRLYKIF-VVFSF 41 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 247,375 Number of Sequences: 336 Number of extensions: 4823 Number of successful extensions: 9 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 122,585 effective HSP length: 60 effective length of database: 102,425 effective search space used: 44145175 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -