BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030731E7_B10_e650_04.seq (1538 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 12_01_0043 + 344084-344452,346672-347546,347635-348145 33 0.46 11_01_0044 + 340486-340854,341855-341911,343100-343974,344065-34... 32 1.1 >12_01_0043 + 344084-344452,346672-347546,347635-348145 Length = 584 Score = 33.5 bits (73), Expect = 0.46 Identities = 13/37 (35%), Positives = 21/37 (56%) Frame = +3 Query: 606 LPMKIDESIPIINGCLSCYFSRVCFSICLIGFGRTGR 716 LP + I ++ GC C+F+ VCF +C+ F + R Sbjct: 119 LPYPLVFLICLVAGCSICWFNTVCFVLCIRSFSSSNR 155 >11_01_0044 + 340486-340854,341855-341911,343100-343974,344065-344398, 345553-345645,345913-346062 Length = 625 Score = 32.3 bits (70), Expect = 1.1 Identities = 11/29 (37%), Positives = 18/29 (62%) Frame = +3 Query: 630 IPIINGCLSCYFSRVCFSICLIGFGRTGR 716 I ++ GC C+F+ VCF +C+ F + R Sbjct: 146 ICLVAGCSICWFNTVCFVLCIRSFSSSNR 174 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 32,278,534 Number of Sequences: 37544 Number of extensions: 621897 Number of successful extensions: 1243 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1212 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1243 length of database: 14,793,348 effective HSP length: 85 effective length of database: 11,602,108 effective search space used: 4954100116 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -