BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030731E7_B10_e650_04.seq (1538 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_34014| Best HMM Match : MFS_1 (HMM E-Value=0.18) 29 7.5 SB_2761| Best HMM Match : zf-TRAF (HMM E-Value=0.26) 29 9.9 >SB_34014| Best HMM Match : MFS_1 (HMM E-Value=0.18) Length = 195 Score = 29.5 bits (63), Expect = 7.5 Identities = 16/51 (31%), Positives = 27/51 (52%) Frame = +2 Query: 302 KSKMAVFGLASAVAGFVKVRYLIDKAVIDNMVFRMHYRITSAILFLCCILV 454 K + G+ +A A + + +A+ID + +R YRI A+ + CILV Sbjct: 144 KRRSLATGIVAAGASIGTLIGPVYQALIDGVGWRNSYRIIGALFSIACILV 194 >SB_2761| Best HMM Match : zf-TRAF (HMM E-Value=0.26) Length = 436 Score = 29.1 bits (62), Expect = 9.9 Identities = 12/31 (38%), Positives = 21/31 (67%), Gaps = 1/31 (3%) Frame = -1 Query: 794 LAGYSYHQQCK-PKNHACRPKSYELFLPPSS 705 L G++++ QC+ P N ++Y+L LPP+S Sbjct: 43 LPGFNHYGQCRGPNNTPWNKQTYKLSLPPAS 73 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 35,936,781 Number of Sequences: 59808 Number of extensions: 692015 Number of successful extensions: 1366 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1230 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1366 length of database: 16,821,457 effective HSP length: 85 effective length of database: 11,737,777 effective search space used: 5012030779 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -