Samia BLAST Result against nematostella

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 030731E7_B09_e642_03.seq
         (1576 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_58684| Best HMM Match : AMP-binding (HMM E-Value=0.36)              29   7.7  

>SB_58684| Best HMM Match : AMP-binding (HMM E-Value=0.36)
          Length = 237

 Score = 29.5 bits (63), Expect = 7.7
 Identities = 15/50 (30%), Positives = 26/50 (52%), Gaps = 2/50 (4%)
 Frame = -2

Query: 825 KLTVLHPTHTIRRYMSSVMDLEIHYFEQISNLCH--GQQHSMQSTVRRIF 682
           ++T L+P +T+R  +  + D + +Y      L H   Q  +  S VRR+F
Sbjct: 59  RVTTLNPQYTVREMVPQLKDSQANYIITTPELIHQVNQAAAKCSCVRRVF 108


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 38,130,224
Number of Sequences: 59808
Number of extensions: 710296
Number of successful extensions: 1013
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 911
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1008
length of database: 16,821,457
effective HSP length: 85
effective length of database: 11,737,777
effective search space used: 5152884103
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)