BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030731E7_B09_e642_03.seq (1576 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value EF990671-1|ABS30732.1| 1256|Anopheles gambiae voltage-gated calc... 26 2.6 AJ278310-1|CAB93496.1| 219|Anopheles gambiae serine protease-li... 25 7.9 >EF990671-1|ABS30732.1| 1256|Anopheles gambiae voltage-gated calcium channel alpha2-delta subunit 1 protein. Length = 1256 Score = 26.2 bits (55), Expect = 2.6 Identities = 14/34 (41%), Positives = 16/34 (47%) Frame = -2 Query: 288 VNINKLCPSIQKHFRKNCMKCTYITFCKKKLHLD 187 V + L S+ KHF KCT T CKK D Sbjct: 917 VGLQFLHESLFKHFINITSKCTASTTCKKNCASD 950 >AJ278310-1|CAB93496.1| 219|Anopheles gambiae serine protease-like protein protein. Length = 219 Score = 24.6 bits (51), Expect = 7.9 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = -3 Query: 980 GPPSXRPIIGSLEHYYDA 927 G P PI GS+ HYY A Sbjct: 157 GSPLICPIPGSVNHYYQA 174 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,300,325 Number of Sequences: 2352 Number of extensions: 24043 Number of successful extensions: 29 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 28 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 29 length of database: 563,979 effective HSP length: 68 effective length of database: 404,043 effective search space used: 184243608 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -