BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030731E7_B07_e626_03.seq (1546 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U00066-9|AAA50743.3| 780|Caenorhabditis elegans Mediator protei... 29 8.8 U00066-8|AAM54164.1| 777|Caenorhabditis elegans Mediator protei... 29 8.8 >U00066-9|AAA50743.3| 780|Caenorhabditis elegans Mediator protein 15, isoform a protein. Length = 780 Score = 29.1 bits (62), Expect = 8.8 Identities = 16/43 (37%), Positives = 20/43 (46%), Gaps = 1/43 (2%) Frame = -2 Query: 228 GTIPPASSLPRGAPPPRPIGWYCCAYGSLS*APATG-APPRMG 103 G I P S P G P P P + ++ PA G PP+MG Sbjct: 176 GQITPGSQAPGGGPTPAPNVPFPNGSSQMNGGPAMGQPPPQMG 218 >U00066-8|AAM54164.1| 777|Caenorhabditis elegans Mediator protein 15, isoform b protein. Length = 777 Score = 29.1 bits (62), Expect = 8.8 Identities = 16/43 (37%), Positives = 20/43 (46%), Gaps = 1/43 (2%) Frame = -2 Query: 228 GTIPPASSLPRGAPPPRPIGWYCCAYGSLS*APATG-APPRMG 103 G I P S P G P P P + ++ PA G PP+MG Sbjct: 173 GQITPGSQAPGGGPTPAPNVPFPNGSSQMNGGPAMGQPPPQMG 215 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 24,112,257 Number of Sequences: 27780 Number of extensions: 442932 Number of successful extensions: 1019 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 898 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1013 length of database: 12,740,198 effective HSP length: 85 effective length of database: 10,378,898 effective search space used: 4452547242 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -