BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= 030731E7_B03_e594_03.seq
(1536 letters)
Database: uniref50
1,657,284 sequences; 575,637,011 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
UniRef50_Q8ID23 Cluster: Mitochondrial carrier protein, putative... 35 4.9
>UniRef50_Q8ID23 Cluster: Mitochondrial carrier protein, putative;
n=1; Plasmodium falciparum 3D7|Rep: Mitochondrial
carrier protein, putative - Plasmodium falciparum
(isolate 3D7)
Length = 576
Score = 35.1 bits (77), Expect = 4.9
Identities = 15/36 (41%), Positives = 24/36 (66%), Gaps = 1/36 (2%)
Frame = -3
Query: 238 NIRYFEYL-HFSTSKPCNKLYKNLYKNR*NSVQFRF 134
NI++ +++ H K NK YKNLY+NR N++ + F
Sbjct: 230 NIKHMKHMEHIKHIKLVNKNYKNLYRNRNNNITYNF 265
Database: uniref50
Posted date: Oct 5, 2007 11:19 AM
Number of letters in database: 575,637,011
Number of sequences in database: 1,657,284
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 1,118,272,835
Number of Sequences: 1657284
Number of extensions: 19764368
Number of successful extensions: 42057
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 39157
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 41985
length of database: 575,637,011
effective HSP length: 104
effective length of database: 403,279,475
effective search space used: 164134746325
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -