BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030731E7_B03_e594_03.seq (1536 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_47204| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.2 SB_53570| Best HMM Match : Y_phosphatase (HMM E-Value=0) 30 5.7 >SB_47204| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 196 Score = 30.7 bits (66), Expect = 3.2 Identities = 14/42 (33%), Positives = 26/42 (61%) Frame = -3 Query: 592 KFKPKLRAVASAIYRKVPSKSVQPFPRLPGTNRQTYKNEKKN 467 K+ K + V+S Y S+S++ PR+ + R+T +NEK++ Sbjct: 62 KYSIKSKDVSSMQYNATLSRSIEIKPRISPSPRETARNEKRS 103 >SB_53570| Best HMM Match : Y_phosphatase (HMM E-Value=0) Length = 2064 Score = 29.9 bits (64), Expect = 5.7 Identities = 22/65 (33%), Positives = 28/65 (43%), Gaps = 3/65 (4%) Frame = -2 Query: 701 NFLIK*SKNISHKFKHLTV---KRSDFIHNFRFFTNYFRQIQA*VTRSSFSYLPKSPVKI 531 +F IK K+LTV K S +HN FTNYF +QA + + K V Sbjct: 673 HFTIKYRAKGQRGAKYLTVDATKTSVVLHNLDKFTNYFIWVQASTKQGDGPFSDKHTVST 732 Query: 530 GPAVP 516 VP Sbjct: 733 AEDVP 737 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 34,478,117 Number of Sequences: 59808 Number of extensions: 624941 Number of successful extensions: 1178 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1048 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1177 length of database: 16,821,457 effective HSP length: 85 effective length of database: 11,737,777 effective search space used: 5000293002 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -