Samia BLAST Result against mosquito

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 030731E7_B03_e594_03.seq
         (1536 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AB107248-1|BAE72063.1|  278|Anopheles gambiae Bcl-2 family prote...    27   1.9  
DQ974161-1|ABJ52801.1|  409|Anopheles gambiae serpin 2 protein.        25   5.8  
AF203339-1|AAF19834.1|  156|Anopheles gambiae immune-responsive ...    25   5.8  

>AB107248-1|BAE72063.1|  278|Anopheles gambiae Bcl-2 family protein
           Anob-1 protein.
          Length = 278

 Score = 26.6 bits (56), Expect = 1.9
 Identities = 12/37 (32%), Positives = 22/37 (59%), Gaps = 5/37 (13%)
 Frame = -1

Query: 183 YTKIYTKIDRILSN-----LDSPNLVSFILHXXARDL 88
           + ++Y+ + R +SN     L  P+ V ++LH  A+DL
Sbjct: 132 HPRLYSNVSRQISNEPWGELTEPDTVGYLLHVVAKDL 168


>DQ974161-1|ABJ52801.1|  409|Anopheles gambiae serpin 2 protein.
          Length = 409

 Score = 25.0 bits (52), Expect = 5.8
 Identities = 7/12 (58%), Positives = 10/12 (83%)
 Frame = +3

Query: 615 PEIVNKIRPFYG 650
           PE+ N ++PFYG
Sbjct: 206 PEVANNVKPFYG 217


>AF203339-1|AAF19834.1|  156|Anopheles gambiae immune-responsive
           serpin-related proteinISerpF1 protein.
          Length = 156

 Score = 25.0 bits (52), Expect = 5.8
 Identities = 7/12 (58%), Positives = 10/12 (83%)
 Frame = +3

Query: 615 PEIVNKIRPFYG 650
           PE+ N ++PFYG
Sbjct: 107 PEVANNVKPFYG 118


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 1,201,318
Number of Sequences: 2352
Number of extensions: 22748
Number of successful extensions: 50
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 49
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 50
length of database: 563,979
effective HSP length: 67
effective length of database: 406,395
effective search space used: 180439380
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)