BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030731E7_B02_e586_04.seq (1524 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM295015-1|CAL25730.1| 549|Tribolium castaneum ecdysone recepto... 27 0.28 U09586-1|AAC47270.1| 425|Tribolium castaneum ORF 1 protein. 24 3.4 >AM295015-1|CAL25730.1| 549|Tribolium castaneum ecdysone receptor (isoform A) protein. Length = 549 Score = 27.5 bits (58), Expect = 0.28 Identities = 11/36 (30%), Positives = 14/36 (38%) Frame = -1 Query: 1353 PXPGPGARPLSXXXGGXTGXPXEGXXXPXPPNXPXG 1246 P PGP + P + G + G P PN G Sbjct: 119 PSPGPPSHPYTVISNGYSSPMSSGSYDPYSPNGKIG 154 >U09586-1|AAC47270.1| 425|Tribolium castaneum ORF 1 protein. Length = 425 Score = 23.8 bits (49), Expect = 3.4 Identities = 11/31 (35%), Positives = 11/31 (35%) Frame = -1 Query: 1353 PXPGPGARPLSXXXGGXTGXPXEGXXXPXPP 1261 P P P A PL G T G PP Sbjct: 90 PEPAPLASPLVQEPGSSTTSATSGAVMASPP 120 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 266,733 Number of Sequences: 336 Number of extensions: 5128 Number of successful extensions: 12 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 122,585 effective HSP length: 60 effective length of database: 102,425 effective search space used: 45783975 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -