BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030731E7_B02_e586_04.seq (1524 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_28519| Best HMM Match : No HMM Matches (HMM E-Value=.) 118 9e-27 SB_24487| Best HMM Match : No HMM Matches (HMM E-Value=.) 110 3e-24 SB_45641| Best HMM Match : No HMM Matches (HMM E-Value=.) 109 6e-24 SB_3496| Best HMM Match : Herpes_UL49_5 (HMM E-Value=7.2) 103 5e-22 SB_16375| Best HMM Match : No HMM Matches (HMM E-Value=.) 98 1e-20 SB_31506| Best HMM Match : No HMM Matches (HMM E-Value=.) 94 3e-19 SB_44767| Best HMM Match : WD40 (HMM E-Value=0.074) 93 5e-19 SB_38028| Best HMM Match : No HMM Matches (HMM E-Value=.) 93 7e-19 SB_6530| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 1e-16 SB_36207| Best HMM Match : 7kD_coat (HMM E-Value=7.6) 85 2e-16 SB_25896| Best HMM Match : No HMM Matches (HMM E-Value=.) 85 2e-16 SB_40068| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) 84 2e-16 SB_12580| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 2e-16 SB_47433| Best HMM Match : No HMM Matches (HMM E-Value=.) 83 6e-16 SB_58792| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 1e-15 SB_55579| Best HMM Match : Rhodanese (HMM E-Value=9.2e-29) 82 1e-15 SB_50054| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 1e-15 SB_49806| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 1e-15 SB_47291| Best HMM Match : PilN (HMM E-Value=0.75) 82 1e-15 SB_45437| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.53) 82 1e-15 SB_42949| Best HMM Match : SRCR (HMM E-Value=1.6e-14) 82 1e-15 SB_31511| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 1e-15 SB_27897| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 1e-15 SB_27010| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 1e-15 SB_26995| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 1e-15 SB_20900| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 1e-15 SB_20814| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 1e-15 SB_15447| Best HMM Match : C1_1 (HMM E-Value=0.11) 82 1e-15 SB_14175| Best HMM Match : GBP_repeat (HMM E-Value=3.8) 82 1e-15 SB_8424| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 1e-15 SB_56358| Best HMM Match : Fork_head (HMM E-Value=1.2e-30) 82 1e-15 SB_56058| Best HMM Match : Phasin (HMM E-Value=2.7) 82 1e-15 SB_52523| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 1e-15 SB_48632| Best HMM Match : DUF265 (HMM E-Value=7.6e-22) 82 1e-15 SB_46830| Best HMM Match : Succ_DH_flav_C (HMM E-Value=3.2e-37) 82 1e-15 SB_42128| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 1e-15 SB_40139| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 1e-15 SB_31293| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 1e-15 SB_29464| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 1e-15 SB_25673| Best HMM Match : MFS_1 (HMM E-Value=0.18) 82 1e-15 SB_24724| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 1e-15 SB_17049| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 1e-15 SB_11401| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 1e-15 SB_9250| Best HMM Match : BAG (HMM E-Value=6.2) 82 1e-15 SB_34678| Best HMM Match : Bromodomain (HMM E-Value=9e-25) 82 1e-15 SB_30699| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 1e-15 SB_10689| Best HMM Match : No HMM Matches (HMM E-Value=.) 82 1e-15 SB_29521| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 2e-15 SB_56660| Best HMM Match : zf-C2H2 (HMM E-Value=0) 81 2e-15 SB_32211| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 2e-15 SB_1214| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 2e-15 SB_6796| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 3e-15 SB_36241| Best HMM Match : No HMM Matches (HMM E-Value=.) 81 3e-15 SB_52265| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 4e-15 SB_44358| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 4e-15 SB_12310| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 4e-15 SB_3970| Best HMM Match : Drf_FH1 (HMM E-Value=1.2) 80 4e-15 SB_55030| Best HMM Match : Toxin_27 (HMM E-Value=1.2) 80 4e-15 SB_41244| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 4e-15 SB_59793| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_59635| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_59624| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_59550| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_59504| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_59286| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_58987| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_58779| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_58768| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_58723| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_58651| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_58615| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_58535| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_58509| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) 80 5e-15 SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_58076| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_57885| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_57850| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_57829| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) 80 5e-15 SB_57711| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_57692| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_57634| Best HMM Match : EGF_2 (HMM E-Value=0.0014) 80 5e-15 SB_57403| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_57371| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_57287| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_57259| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) 80 5e-15 SB_57194| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_57193| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_57151| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_57135| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_57120| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_56982| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_56880| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_56746| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_56676| Best HMM Match : Peptidase_C1 (HMM E-Value=0.0027) 80 5e-15 SB_56642| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_56581| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_56546| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_56496| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_56428| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_56369| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_56281| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_56027| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_56013| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_55938| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_55921| Best HMM Match : Aldo_ket_red (HMM E-Value=0.16) 80 5e-15 SB_55868| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_55798| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_55789| Best HMM Match : ERG2_Sigma1R (HMM E-Value=3.6e-10) 80 5e-15 SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_55719| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_55703| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_55626| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_55592| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_55288| Best HMM Match : TLD (HMM E-Value=0.00092) 80 5e-15 SB_55192| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_55155| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_55099| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_55072| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_55011| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_54989| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_54840| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_54799| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_54578| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_54508| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_54473| Best HMM Match : DLIC (HMM E-Value=0) 80 5e-15 SB_54247| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_54170| Best HMM Match : Coronavirus_NS4 (HMM E-Value=6.1) 80 5e-15 SB_54136| Best HMM Match : YbgT_YccB (HMM E-Value=3) 80 5e-15 SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) 80 5e-15 SB_53753| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_53666| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_53625| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_53515| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_53366| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_53231| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_53118| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_52850| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_52844| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_52789| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_52731| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) 80 5e-15 SB_52427| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_52394| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_52260| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_52253| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_52161| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_52130| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_52086| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_52085| Best HMM Match : TIL (HMM E-Value=2.5) 80 5e-15 SB_51989| Best HMM Match : Extensin_2 (HMM E-Value=0.29) 80 5e-15 SB_51638| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_51529| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_51427| Best HMM Match : DUF855 (HMM E-Value=4) 80 5e-15 SB_51409| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_51320| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_50850| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) 80 5e-15 SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_50493| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_50473| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_50417| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_50270| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_50195| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_49896| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_49839| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_49814| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_49644| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_49542| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_49530| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_49495| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_49465| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_49395| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_49211| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_49150| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_49117| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_49064| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1) 80 5e-15 SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_48522| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_48514| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_48486| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_48393| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_48129| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_48100| Best HMM Match : Transformer (HMM E-Value=5.4) 80 5e-15 SB_48063| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_48045| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_48039| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_48026| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_47872| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_47732| Best HMM Match : Pkinase (HMM E-Value=0.0016) 80 5e-15 SB_47536| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_47480| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_47399| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_47315| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_47276| Best HMM Match : DUF851 (HMM E-Value=9.6) 80 5e-15 SB_47213| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_46889| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) 80 5e-15 SB_46651| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_46649| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_46589| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_46529| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_46517| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_46424| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_46412| Best HMM Match : HEAT (HMM E-Value=8) 80 5e-15 SB_46374| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_46361| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_46344| Best HMM Match : ig (HMM E-Value=0.0082) 80 5e-15 SB_46321| Best HMM Match : DUF765 (HMM E-Value=3.4) 80 5e-15 SB_46308| Best HMM Match : IMS (HMM E-Value=0) 80 5e-15 SB_46303| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_46194| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_45914| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_45887| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_45813| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_45642| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_45524| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_45424| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_45381| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_45291| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_45068| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_44920| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_44900| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_44894| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_44806| Best HMM Match : Hist_deacetyl (HMM E-Value=0) 80 5e-15 SB_44800| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_44789| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_44778| Best HMM Match : TPR_2 (HMM E-Value=0.00023) 80 5e-15 SB_44606| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_44604| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_44516| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_44466| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_44411| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_44401| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_44392| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_44259| Best HMM Match : MORN (HMM E-Value=3.7) 80 5e-15 SB_44076| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_44013| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_43970| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_43960| Best HMM Match : Toxin_19 (HMM E-Value=0.56) 80 5e-15 SB_43909| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_43701| Best HMM Match : ubiquitin (HMM E-Value=0.003) 80 5e-15 SB_43671| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_43630| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_43618| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_43569| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_43510| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_43145| Best HMM Match : PEGSRP (HMM E-Value=7.2) 80 5e-15 SB_43138| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.3e-14) 80 5e-15 SB_43098| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_42990| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_42937| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_42936| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_42924| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_42831| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_42730| Best HMM Match : Ank (HMM E-Value=0.00016) 80 5e-15 SB_42725| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_42655| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_42646| Best HMM Match : DUF765 (HMM E-Value=5.8) 80 5e-15 SB_42337| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_42313| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_42158| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_42069| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_42015| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_41881| Best HMM Match : Extensin_1 (HMM E-Value=5.5) 80 5e-15 SB_41827| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_41806| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_41779| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_41728| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_41712| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_41568| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_41481| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_41365| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_41112| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_41066| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_41011| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_40939| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_40862| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_40614| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_40610| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_40583| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_40566| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_40550| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_40471| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_40465| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_40462| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_40265| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_40240| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_40230| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_40107| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_39690| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_39438| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_39406| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_39373| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_39311| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_39280| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_39247| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_39201| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_39107| Best HMM Match : Lyase_8 (HMM E-Value=0.016) 80 5e-15 SB_38948| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_38916| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_38893| Best HMM Match : UMPH-1 (HMM E-Value=2.3e-21) 80 5e-15 SB_38767| Best HMM Match : Filamin (HMM E-Value=0.034) 80 5e-15 SB_38726| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_38504| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_38387| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_38141| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_38016| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_37962| Best HMM Match : Tcp10_C (HMM E-Value=5.9e-36) 80 5e-15 SB_37690| Best HMM Match : IgG_binding_B (HMM E-Value=4.2) 80 5e-15 SB_37661| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_37635| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_37536| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_37412| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_37372| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_37245| Best HMM Match : Disintegrin (HMM E-Value=7.9) 80 5e-15 SB_37147| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_37066| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_37038| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_37030| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_36958| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_36941| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_36865| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_36853| Best HMM Match : DNA_pol_B_exo (HMM E-Value=4.2) 80 5e-15 SB_36823| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_36358| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_35997| Best HMM Match : Phage_fiber (HMM E-Value=0.78) 80 5e-15 SB_35988| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_35856| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_35768| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_35732| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_35726| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_35698| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_35689| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_35635| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_35611| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_35484| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_35280| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_35257| Best HMM Match : Sec8_exocyst (HMM E-Value=0.59) 80 5e-15 SB_35237| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_35223| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_35140| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_35136| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_35129| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_35057| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_35026| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_34829| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_34793| Best HMM Match : TIL (HMM E-Value=4.5) 80 5e-15 SB_34738| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_34683| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_34666| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_34501| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_34487| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_34462| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_34192| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_34190| Best HMM Match : MAM (HMM E-Value=0) 80 5e-15 SB_34054| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_34015| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_33934| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_33883| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_33752| Best HMM Match : I-set (HMM E-Value=3.7e-15) 80 5e-15 SB_33698| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_33625| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_33491| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_33475| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_33403| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_33369| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_33319| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_33270| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_33216| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_33186| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_32832| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_32674| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_32571| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_32529| Best HMM Match : Laminin_G_2 (HMM E-Value=0) 80 5e-15 SB_32525| Best HMM Match : DED (HMM E-Value=0.81) 80 5e-15 SB_32508| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_32440| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_32437| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_32426| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_32411| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_32339| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_32317| Best HMM Match : Cadherin (HMM E-Value=1.5e-28) 80 5e-15 SB_32310| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_32140| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_32110| Best HMM Match : PEGSRP (HMM E-Value=9.6) 80 5e-15 SB_31831| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_31818| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_31776| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_31757| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_31658| Best HMM Match : Arm (HMM E-Value=0.91) 80 5e-15 SB_31632| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_31490| Best HMM Match : Aa_trans (HMM E-Value=4.9e-31) 80 5e-15 SB_31476| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_31450| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_31401| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_31375| Best HMM Match : IQ (HMM E-Value=0.00076) 80 5e-15 SB_31367| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_31351| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_31291| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_31276| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_31227| Best HMM Match : RIO1 (HMM E-Value=0.13) 80 5e-15 SB_31127| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_31056| Best HMM Match : Virus_P-coat (HMM E-Value=6.4) 80 5e-15 SB_30978| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_30905| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_30849| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_30810| Best HMM Match : JmjC (HMM E-Value=0.0021) 80 5e-15 SB_30786| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_30644| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_30600| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_30578| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_30576| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_30457| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_30432| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_30415| Best HMM Match : M (HMM E-Value=6.5e-05) 80 5e-15 SB_30336| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_30192| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_29871| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_29660| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_29646| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_29445| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_29397| Best HMM Match : fn3 (HMM E-Value=0.038) 80 5e-15 SB_29341| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_29332| Best HMM Match : PAN (HMM E-Value=0.039) 80 5e-15 SB_29330| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_29217| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_29207| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_29178| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_29126| Best HMM Match : FUN14 (HMM E-Value=1.8) 80 5e-15 SB_29104| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_29084| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_29039| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_29037| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_29000| Best HMM Match : DUF551 (HMM E-Value=2.2) 80 5e-15 SB_28961| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_28940| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_28922| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_28866| Best HMM Match : PhdYeFM (HMM E-Value=8.3) 80 5e-15 SB_28825| Best HMM Match : COX8 (HMM E-Value=4.5) 80 5e-15 SB_28717| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_28646| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_28582| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_28530| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_28324| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_28283| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_28269| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_28216| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_28148| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_28058| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_28014| Best HMM Match : HOOK (HMM E-Value=1.8e-13) 80 5e-15 SB_27927| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_27874| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_27823| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_27779| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_27762| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_27619| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_27362| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_27165| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_27109| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_27108| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_27047| Best HMM Match : No HMM Matches (HMM E-Value=.) 80 5e-15 SB_26735| Best HMM Match : rve (HMM E-Value=0.00066) 80 5e-15 >SB_28519| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 118 bits (285), Expect = 9e-27 Identities = 54/63 (85%), Positives = 57/63 (90%) Frame = +2 Query: 587 IRPIVSRITIHWPSFYTVVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPXQQLRSLX 766 +RP+VSRITIHW SFY VVTGKTLALPNLIALQHIPLSPAGVIA+ RTDRP QQLRSL Sbjct: 33 LRPVVSRITIHWTSFYNVVTGKTLALPNLIALQHIPLSPAGVIAEEARTDRPSQQLRSLN 92 Query: 767 GEW 775 GEW Sbjct: 93 GEW 95 >SB_24487| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 110 bits (264), Expect = 3e-24 Identities = 50/61 (81%), Positives = 53/61 (86%) Frame = +2 Query: 593 PIVSRITIHWPSFYTVVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPXQQLRSLXGE 772 P +SRITIHWPSFY VVTGKTLALPNLIALQHIPLSPAG+ + RTDRP QQLRSL GE Sbjct: 77 PYMSRITIHWPSFYNVVTGKTLALPNLIALQHIPLSPAGLHREEARTDRPSQQLRSLNGE 136 Query: 773 W 775 W Sbjct: 137 W 137 >SB_45641| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 109 bits (262), Expect = 6e-24 Identities = 50/58 (86%), Positives = 52/58 (89%) Frame = +2 Query: 602 SRITIHWPSFYTVVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPXQQLRSLXGEW 775 SRITIHWPSFY VVTGKTLALPNLIALQHIPLSPAGV ++ RTDRP QQLRSL GEW Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNLIALQHIPLSPAGVNSEEARTDRPSQQLRSLNGEW 59 >SB_3496| Best HMM Match : Herpes_UL49_5 (HMM E-Value=7.2) Length = 98 Score = 103 bits (246), Expect = 5e-22 Identities = 49/58 (84%), Positives = 50/58 (86%) Frame = +2 Query: 602 SRITIHWPSFYTVVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPXQQLRSLXGEW 775 SRITIHWPSFY VVTGKTLALPNLIALQHIPLSPAGVIAKRP +QLRSL GEW Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNLIALQHIPLSPAGVIAKRPAPIALPKQLRSLNGEW 59 >SB_16375| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 98.3 bits (234), Expect = 1e-20 Identities = 44/54 (81%), Positives = 47/54 (87%) Frame = +2 Query: 617 HWPSFYTVVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPXQQLRSLXGEWQ 778 HWPSFY VVTGKTLALPNLIALQHIPLSPAG ++ RTDRP QQLRSL GEW+ Sbjct: 5 HWPSFYNVVTGKTLALPNLIALQHIPLSPAGRNSEEARTDRPSQQLRSLNGEWR 58 >SB_31506| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 93.9 bits (223), Expect = 3e-19 Identities = 44/58 (75%), Positives = 47/58 (81%) Frame = +2 Query: 602 SRITIHWPSFYTVVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPXQQLRSLXGEW 775 SRITIHWPSFY VVTGKTLALPNLIALQHIP + ++ RTDRP QQLRSL GEW Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNLIALQHIPPFASWRNSEEARTDRPSQQLRSLNGEW 59 >SB_44767| Best HMM Match : WD40 (HMM E-Value=0.074) Length = 532 Score = 93.1 bits (221), Expect = 5e-19 Identities = 42/48 (87%), Positives = 42/48 (87%) Frame = +1 Query: 631 LHRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPXPTVAQPXXRM 774 L RRDWENPGVTQLNRLAAHPPFASWRNSE PHRSP PTVAQP RM Sbjct: 348 LQRRDWENPGVTQLNRLAAHPPFASWRNSER-PHRSPFPTVAQPEWRM 394 >SB_38028| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 92.7 bits (220), Expect = 7e-19 Identities = 42/58 (72%), Positives = 46/58 (79%) Frame = +2 Query: 602 SRITIHWPSFYTVVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPXQQLRSLXGEW 775 SRITIHWPSFY VVTGKTLALPNL L+HIPL + ++ RTDRP QQLRSL GEW Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNLFDLRHIPLYASCTTSEEARTDRPSQQLRSLNGEW 59 >SB_6530| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 85.0 bits (201), Expect = 1e-16 Identities = 41/58 (70%), Positives = 45/58 (77%) Frame = +2 Query: 602 SRITIHWPSFYTVVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPXQQLRSLXGEW 775 SRITIHWPSFY VVTGKTLALPNLIALQ P + ++ RTDRP Q+LRSL GEW Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNLIALQLHPPFASWRNSEEARTDRPSQRLRSLNGEW 59 >SB_36207| Best HMM Match : 7kD_coat (HMM E-Value=7.6) Length = 98 Score = 84.6 bits (200), Expect = 2e-16 Identities = 40/45 (88%), Positives = 41/45 (91%) Frame = -2 Query: 746 GKGDRCGASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 612 G+G ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 54 GEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 98 Score = 31.9 bits (69), Expect = 1.4 Identities = 14/34 (41%), Positives = 18/34 (52%) Frame = -1 Query: 774 HSPXRLRNCWXGRSVRGLFAITPAGERGMCCKAI 673 HSP RLRNC GRSVR + + G + + Sbjct: 45 HSPFRLRNCGEGRSVRASSLLRQLAKGGCAARRL 78 >SB_25896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 97 Score = 84.6 bits (200), Expect = 2e-16 Identities = 41/58 (70%), Positives = 44/58 (75%) Frame = +2 Query: 602 SRITIHWPSFYTVVTGKTLALPNLIALQHIPLSPAGVIAKRPRTDRPXQQLRSLXGEW 775 SRITIHWPSFY VVTGKTLALPNLIAL P + ++ RTDRP QQLRSL GEW Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNLIALAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 59 >SB_40068| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) Length = 406 Score = 84.2 bits (199), Expect = 2e-16 Identities = 41/51 (80%), Positives = 42/51 (82%) Frame = -2 Query: 764 SGCATVGKGDRCGASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 612 SG +G ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 356 SGLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 406 >SB_12580| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 84.2 bits (199), Expect = 2e-16 Identities = 41/51 (80%), Positives = 42/51 (82%) Frame = -2 Query: 764 SGCATVGKGDRCGASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 612 SG +G ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 81 SGLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 131 >SB_47433| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 49 Score = 83.0 bits (196), Expect = 6e-16 Identities = 40/48 (83%), Positives = 42/48 (87%) Frame = -2 Query: 755 ATVGKGDRCGASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 612 A + +G ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 2 AQLWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 49 >SB_58792| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 82.2 bits (194), Expect = 1e-15 Identities = 39/44 (88%), Positives = 40/44 (90%) Frame = -2 Query: 743 KGDRCGASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 612 +G ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 14 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 57 Score = 37.1 bits (82), Expect = 0.037 Identities = 15/34 (44%), Positives = 19/34 (55%) Frame = -1 Query: 774 HSPXRLRNCWXGRSVRGLFAITPAGERGMCCKAI 673 HSP RLRNCW GRSVR + + G + + Sbjct: 4 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRL 37 >SB_55579| Best HMM Match : Rhodanese (HMM E-Value=9.2e-29) Length = 269 Score = 82.2 bits (194), Expect = 1e-15 Identities = 39/44 (88%), Positives = 40/44 (90%) Frame = -2 Query: 743 KGDRCGASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 612 +G ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 226 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 269 Score = 37.1 bits (82), Expect = 0.037 Identities = 15/34 (44%), Positives = 19/34 (55%) Frame = -1 Query: 774 HSPXRLRNCWXGRSVRGLFAITPAGERGMCCKAI 673 HSP RLRNCW GRSVR + + G + + Sbjct: 216 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRL 249 >SB_50054| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 937 Score = 82.2 bits (194), Expect = 1e-15 Identities = 39/44 (88%), Positives = 40/44 (90%) Frame = -2 Query: 743 KGDRCGASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 612 +G ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 894 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 937 >SB_49806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 82.2 bits (194), Expect = 1e-15 Identities = 39/44 (88%), Positives = 40/44 (90%) Frame = -2 Query: 743 KGDRCGASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 612 +G ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 7 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 50 >SB_47291| Best HMM Match : PilN (HMM E-Value=0.75) Length = 424 Score = 82.2 bits (194), Expect = 1e-15 Identities = 39/44 (88%), Positives = 40/44 (90%) Frame = -2 Query: 743 KGDRCGASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 612 +G ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 381 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 424 Score = 37.1 bits (82), Expect = 0.037 Identities = 15/34 (44%), Positives = 19/34 (55%) Frame = -1 Query: 774 HSPXRLRNCWXGRSVRGLFAITPAGERGMCCKAI 673 HSP RLRNCW GRSVR + + G + + Sbjct: 371 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRL 404 >SB_45437| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.53) Length = 273 Score = 82.2 bits (194), Expect = 1e-15 Identities = 39/44 (88%), Positives = 40/44 (90%) Frame = -2 Query: 743 KGDRCGASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 612 +G ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 230 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 273 >SB_42949| Best HMM Match : SRCR (HMM E-Value=1.6e-14) Length = 340 Score = 82.2 bits (194), Expect = 1e-15 Identities = 39/44 (88%), Positives = 40/44 (90%) Frame = -2 Query: 743 KGDRCGASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 612 +G ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 297 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 340 Score = 37.1 bits (82), Expect = 0.037 Identities = 15/34 (44%), Positives = 19/34 (55%) Frame = -1 Query: 774 HSPXRLRNCWXGRSVRGLFAITPAGERGMCCKAI 673 HSP RLRNCW GRSVR + + G + + Sbjct: 287 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRL 320 >SB_31511| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 372 Score = 82.2 bits (194), Expect = 1e-15 Identities = 39/44 (88%), Positives = 40/44 (90%) Frame = -2 Query: 743 KGDRCGASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 612 +G ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 14 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 57 Score = 37.1 bits (82), Expect = 0.037 Identities = 15/34 (44%), Positives = 19/34 (55%) Frame = -1 Query: 774 HSPXRLRNCWXGRSVRGLFAITPAGERGMCCKAI 673 HSP RLRNCW GRSVR + + G + + Sbjct: 4 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRL 37 >SB_27897| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 82.2 bits (194), Expect = 1e-15 Identities = 39/44 (88%), Positives = 40/44 (90%) Frame = -2 Query: 743 KGDRCGASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 612 +G ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 7 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 50 >SB_27010| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 82.2 bits (194), Expect = 1e-15 Identities = 39/44 (88%), Positives = 40/44 (90%) Frame = -2 Query: 743 KGDRCGASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 612 +G ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 7 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 50 >SB_26995| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 82.2 bits (194), Expect = 1e-15 Identities = 39/44 (88%), Positives = 40/44 (90%) Frame = -2 Query: 743 KGDRCGASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 612 +G ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 14 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 57 Score = 37.1 bits (82), Expect = 0.037 Identities = 15/34 (44%), Positives = 19/34 (55%) Frame = -1 Query: 774 HSPXRLRNCWXGRSVRGLFAITPAGERGMCCKAI 673 HSP RLRNCW GRSVR + + G + + Sbjct: 4 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRL 37 >SB_20900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 82.2 bits (194), Expect = 1e-15 Identities = 39/44 (88%), Positives = 40/44 (90%) Frame = -2 Query: 743 KGDRCGASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 612 +G ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 14 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 57 Score = 37.1 bits (82), Expect = 0.037 Identities = 15/34 (44%), Positives = 19/34 (55%) Frame = -1 Query: 774 HSPXRLRNCWXGRSVRGLFAITPAGERGMCCKAI 673 HSP RLRNCW GRSVR + + G + + Sbjct: 4 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRL 37 >SB_20814| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 82.2 bits (194), Expect = 1e-15 Identities = 39/44 (88%), Positives = 40/44 (90%) Frame = -2 Query: 743 KGDRCGASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 612 +G ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 37 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 80 Score = 37.1 bits (82), Expect = 0.037 Identities = 15/34 (44%), Positives = 19/34 (55%) Frame = -1 Query: 774 HSPXRLRNCWXGRSVRGLFAITPAGERGMCCKAI 673 HSP RLRNCW GRSVR + + G + + Sbjct: 27 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRL 60 >SB_15447| Best HMM Match : C1_1 (HMM E-Value=0.11) Length = 316 Score = 82.2 bits (194), Expect = 1e-15 Identities = 39/44 (88%), Positives = 40/44 (90%) Frame = -2 Query: 743 KGDRCGASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 612 +G ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 273 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 316 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/30 (40%), Positives = 16/30 (53%) Frame = -1 Query: 762 RLRNCWXGRSVRGLFAITPAGERGMCCKAI 673 RLRNCW GRSVR + + G + + Sbjct: 267 RLRNCWEGRSVRASSLLRQLAKGGCAARRL 296 >SB_14175| Best HMM Match : GBP_repeat (HMM E-Value=3.8) Length = 300 Score = 82.2 bits (194), Expect = 1e-15 Identities = 39/44 (88%), Positives = 40/44 (90%) Frame = -2 Query: 743 KGDRCGASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 612 +G ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 257 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 300 >SB_8424| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 82.2 bits (194), Expect = 1e-15 Identities = 39/44 (88%), Positives = 40/44 (90%) Frame = -2 Query: 743 KGDRCGASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 612 +G ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 7 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 50 >SB_56358| Best HMM Match : Fork_head (HMM E-Value=1.2e-30) Length = 289 Score = 82.2 bits (194), Expect = 1e-15 Identities = 39/44 (88%), Positives = 40/44 (90%) Frame = -2 Query: 743 KGDRCGASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 612 +G ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 246 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 289 Score = 31.5 bits (68), Expect = 1.8 Identities = 13/34 (38%), Positives = 17/34 (50%) Frame = -1 Query: 774 HSPXRLRNCWXGRSVRGLFAITPAGERGMCCKAI 673 H RLRNCW GRSVR + + G + + Sbjct: 236 HLTIRLRNCWEGRSVRASSLLRQLAKGGCAARRL 269 >SB_56058| Best HMM Match : Phasin (HMM E-Value=2.7) Length = 314 Score = 82.2 bits (194), Expect = 1e-15 Identities = 39/44 (88%), Positives = 40/44 (90%) Frame = -2 Query: 743 KGDRCGASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 612 +G ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 271 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 314 Score = 37.9 bits (84), Expect = 0.021 Identities = 17/43 (39%), Positives = 21/43 (48%) Frame = -1 Query: 801 TKILTLXICHSPXRLRNCWXGRSVRGLFAITPAGERGMCCKAI 673 T I HSP RLRNCW GRSVR + + G + + Sbjct: 252 TNITIQGASHSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRL 294 >SB_52523| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 498 Score = 82.2 bits (194), Expect = 1e-15 Identities = 39/44 (88%), Positives = 40/44 (90%) Frame = -2 Query: 743 KGDRCGASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 612 +G ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 455 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 498 Score = 37.1 bits (82), Expect = 0.037 Identities = 15/34 (44%), Positives = 19/34 (55%) Frame = -1 Query: 774 HSPXRLRNCWXGRSVRGLFAITPAGERGMCCKAI 673 HSP RLRNCW GRSVR + + G + + Sbjct: 445 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRL 478 >SB_48632| Best HMM Match : DUF265 (HMM E-Value=7.6e-22) Length = 455 Score = 82.2 bits (194), Expect = 1e-15 Identities = 39/44 (88%), Positives = 40/44 (90%) Frame = -2 Query: 743 KGDRCGASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 612 +G ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 124 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 167 >SB_46830| Best HMM Match : Succ_DH_flav_C (HMM E-Value=3.2e-37) Length = 333 Score = 82.2 bits (194), Expect = 1e-15 Identities = 39/44 (88%), Positives = 40/44 (90%) Frame = -2 Query: 743 KGDRCGASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 612 +G ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 290 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 333 Score = 37.1 bits (82), Expect = 0.037 Identities = 15/34 (44%), Positives = 19/34 (55%) Frame = -1 Query: 774 HSPXRLRNCWXGRSVRGLFAITPAGERGMCCKAI 673 HSP RLRNCW GRSVR + + G + + Sbjct: 280 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRL 313 >SB_42128| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 82.2 bits (194), Expect = 1e-15 Identities = 39/44 (88%), Positives = 40/44 (90%) Frame = -2 Query: 743 KGDRCGASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 612 +G ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 140 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 183 Score = 37.1 bits (82), Expect = 0.037 Identities = 15/34 (44%), Positives = 19/34 (55%) Frame = -1 Query: 774 HSPXRLRNCWXGRSVRGLFAITPAGERGMCCKAI 673 HSP RLRNCW GRSVR + + G + + Sbjct: 130 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRL 163 >SB_40139| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 82.2 bits (194), Expect = 1e-15 Identities = 39/44 (88%), Positives = 40/44 (90%) Frame = -2 Query: 743 KGDRCGASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 612 +G ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 14 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 57 Score = 37.1 bits (82), Expect = 0.037 Identities = 15/34 (44%), Positives = 19/34 (55%) Frame = -1 Query: 774 HSPXRLRNCWXGRSVRGLFAITPAGERGMCCKAI 673 HSP RLRNCW GRSVR + + G + + Sbjct: 4 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRL 37 >SB_31293| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 82.2 bits (194), Expect = 1e-15 Identities = 39/44 (88%), Positives = 40/44 (90%) Frame = -2 Query: 743 KGDRCGASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 612 +G ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 14 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 57 Score = 37.1 bits (82), Expect = 0.037 Identities = 15/34 (44%), Positives = 19/34 (55%) Frame = -1 Query: 774 HSPXRLRNCWXGRSVRGLFAITPAGERGMCCKAI 673 HSP RLRNCW GRSVR + + G + + Sbjct: 4 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRL 37 >SB_29464| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 242 Score = 82.2 bits (194), Expect = 1e-15 Identities = 39/44 (88%), Positives = 40/44 (90%) Frame = -2 Query: 743 KGDRCGASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 612 +G ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 199 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 242 >SB_25673| Best HMM Match : MFS_1 (HMM E-Value=0.18) Length = 634 Score = 82.2 bits (194), Expect = 1e-15 Identities = 39/44 (88%), Positives = 40/44 (90%) Frame = -2 Query: 743 KGDRCGASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 612 +G ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 591 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 634 Score = 37.1 bits (82), Expect = 0.037 Identities = 15/34 (44%), Positives = 19/34 (55%) Frame = -1 Query: 774 HSPXRLRNCWXGRSVRGLFAITPAGERGMCCKAI 673 HSP RLRNCW GRSVR + + G + + Sbjct: 581 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRL 614 >SB_24724| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2021 Score = 82.2 bits (194), Expect = 1e-15 Identities = 39/44 (88%), Positives = 40/44 (90%) Frame = -2 Query: 743 KGDRCGASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 612 +G ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 227 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 270 >SB_17049| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 548 Score = 82.2 bits (194), Expect = 1e-15 Identities = 39/44 (88%), Positives = 40/44 (90%) Frame = -2 Query: 743 KGDRCGASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 612 +G ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 505 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 548 Score = 37.1 bits (82), Expect = 0.037 Identities = 15/34 (44%), Positives = 19/34 (55%) Frame = -1 Query: 774 HSPXRLRNCWXGRSVRGLFAITPAGERGMCCKAI 673 HSP RLRNCW GRSVR + + G + + Sbjct: 495 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRL 528 >SB_11401| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 439 Score = 82.2 bits (194), Expect = 1e-15 Identities = 39/44 (88%), Positives = 40/44 (90%) Frame = -2 Query: 743 KGDRCGASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 612 +G ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 396 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 439 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/30 (40%), Positives = 16/30 (53%) Frame = -1 Query: 762 RLRNCWXGRSVRGLFAITPAGERGMCCKAI 673 RLRNCW GRSVR + + G + + Sbjct: 390 RLRNCWEGRSVRASSLLRQLAKGGCAARRL 419 >SB_9250| Best HMM Match : BAG (HMM E-Value=6.2) Length = 232 Score = 82.2 bits (194), Expect = 1e-15 Identities = 39/44 (88%), Positives = 40/44 (90%) Frame = -2 Query: 743 KGDRCGASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 612 +G ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 189 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 232 Score = 37.1 bits (82), Expect = 0.037 Identities = 15/34 (44%), Positives = 19/34 (55%) Frame = -1 Query: 774 HSPXRLRNCWXGRSVRGLFAITPAGERGMCCKAI 673 HSP RLRNCW GRSVR + + G + + Sbjct: 179 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRL 212 >SB_34678| Best HMM Match : Bromodomain (HMM E-Value=9e-25) Length = 1137 Score = 81.8 bits (193), Expect = 1e-15 Identities = 39/55 (70%), Positives = 40/55 (72%) Frame = +1 Query: 562 NSRGGPVXXXXXXXXXXXXLAVVLHRRDWENPGVTQLNRLAAHPPFASWRNSEEA 726 N RG P+ LAVVL RRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 512 NQRGDPLESTCRHASLA--LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 564 Score = 35.5 bits (78), Expect = 0.11 Identities = 14/21 (66%), Positives = 17/21 (80%) Frame = +2 Query: 716 AKRPRTDRPXQQLRSLXGEWQ 778 ++ RTDRP QQLRSL GEW+ Sbjct: 561 SEEARTDRPSQQLRSLNGEWR 581 >SB_30699| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 43 Score = 81.8 bits (193), Expect = 1e-15 Identities = 38/38 (100%), Positives = 38/38 (100%) Frame = -2 Query: 725 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 612 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 6 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 43 >SB_10689| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 43 Score = 81.8 bits (193), Expect = 1e-15 Identities = 38/38 (100%), Positives = 38/38 (100%) Frame = -2 Query: 725 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 612 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 6 ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 43 >SB_29521| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 81.4 bits (192), Expect = 2e-15 Identities = 40/49 (81%), Positives = 41/49 (83%) Frame = -2 Query: 743 KGDRCGASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL*YDSL 597 +G ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASE D L Sbjct: 14 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEFPGDPL 62 Score = 79.8 bits (188), Expect = 5e-15 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 619 LAVVLHRRDWENPGVTQLNRLAAHPPFASWRNSEEA 726 LAVVL RRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 85 [lacZ-alpha fragment, 36 aa] 120 Score = 37.1 bits (82), Expect = 0.037 Identities = 15/34 (44%), Positives = 19/34 (55%) Frame = -1 Query: 774 HSPXRLRNCWXGRSVRGLFAITPAGERGMCCKAI 673 HSP RLRNCW GRSVR + + G + + Sbjct: 4 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRL 37 Score = 35.1 bits (77), Expect = 0.15 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +2 Query: 716 AKRPRTDRPXQQLRSLXGEW 775 ++ RTDRP QQLRSL GEW Sbjct: 117 SEEARTDRPSQQLRSLNGEW 136 >SB_56660| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 917 Score = 81.0 bits (191), Expect = 2e-15 Identities = 39/54 (72%), Positives = 40/54 (74%) Frame = +1 Query: 565 SRGGPVXXXXXXXXXXXXLAVVLHRRDWENPGVTQLNRLAAHPPFASWRNSEEA 726 SRG P+ LAVVL RRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 817 SRGDPLESTCRHASLA--LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 868 Score = 35.5 bits (78), Expect = 0.11 Identities = 14/21 (66%), Positives = 17/21 (80%) Frame = +2 Query: 716 AKRPRTDRPXQQLRSLXGEWQ 778 ++ RTDRP QQLRSL GEW+ Sbjct: 865 SEEARTDRPSQQLRSLNGEWR 885 >SB_32211| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 109 Score = 81.0 bits (191), Expect = 2e-15 Identities = 36/37 (97%), Positives = 36/37 (97%) Frame = +2 Query: 617 HWPSFYTVVTGKTLALPNLIALQHIPLSPAGVIAKRP 727 HWPSFY VVTGKTLALPNLIALQHIPLSPAGVIAKRP Sbjct: 62 HWPSFYNVVTGKTLALPNLIALQHIPLSPAGVIAKRP 98 >SB_1214| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 104 Score = 81.0 bits (191), Expect = 2e-15 Identities = 36/37 (97%), Positives = 36/37 (97%) Frame = +2 Query: 617 HWPSFYTVVTGKTLALPNLIALQHIPLSPAGVIAKRP 727 HWPSFY VVTGKTLALPNLIALQHIPLSPAGVIAKRP Sbjct: 57 HWPSFYNVVTGKTLALPNLIALQHIPLSPAGVIAKRP 93 >SB_6796| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 925 Score = 80.6 bits (190), Expect = 3e-15 Identities = 38/43 (88%), Positives = 39/43 (90%) Frame = -2 Query: 743 KGDRCGASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASE 615 +G ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASE Sbjct: 536 EGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASE 578 Score = 29.9 bits (64), Expect = 5.6 Identities = 12/30 (40%), Positives = 16/30 (53%) Frame = -1 Query: 762 RLRNCWXGRSVRGLFAITPAGERGMCCKAI 673 RLRNCW GRSVR + + G + + Sbjct: 530 RLRNCWEGRSVRASSLLRQLAKGGCAARRL 559 >SB_36241| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 100 Score = 80.6 bits (190), Expect = 3e-15 Identities = 37/46 (80%), Positives = 38/46 (82%) Frame = +1 Query: 619 LAVVLHRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPXPTVA 756 LAVVL RRDWENPGVTQLNRLAAHPPFASWRNSEEA P + A Sbjct: 54 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSHSCA 99 >SB_52265| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 80.2 bits (189), Expect = 4e-15 Identities = 44/78 (56%), Positives = 45/78 (57%) Frame = +1 Query: 493 YLAASRNKCPLYXXXXXXXXXXXNSRGGPVXXXXXXXXXXXXLAVVLHRRDWENPGVTQL 672 YL S N CP S G P+ LAVVL RRDWENPGVTQL Sbjct: 98 YLLGSTNPCP------TAVHMEPFSTGDPLESTCRHASLA--LAVVLQRRDWENPGVTQL 149 Query: 673 NRLAAHPPFASWRNSEEA 726 NRLAAHPPFASWRNSEEA Sbjct: 150 NRLAAHPPFASWRNSEEA 167 Score = 35.5 bits (78), Expect = 0.11 Identities = 14/21 (66%), Positives = 17/21 (80%) Frame = +2 Query: 716 AKRPRTDRPXQQLRSLXGEWQ 778 ++ RTDRP QQLRSL GEW+ Sbjct: 164 SEEARTDRPSQQLRSLNGEWR 184 >SB_44358| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 80.2 bits (189), Expect = 4e-15 Identities = 38/55 (69%), Positives = 41/55 (74%) Frame = +1 Query: 562 NSRGGPVXXXXXXXXXXXXLAVVLHRRDWENPGVTQLNRLAAHPPFASWRNSEEA 726 ++RG P+ LAVVL RRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 79 STRGDPLESTCRHASLA--LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 131 Score = 35.5 bits (78), Expect = 0.11 Identities = 14/21 (66%), Positives = 17/21 (80%) Frame = +2 Query: 716 AKRPRTDRPXQQLRSLXGEWQ 778 ++ RTDRP QQLRSL GEW+ Sbjct: 128 SEEARTDRPSQQLRSLNGEWR 148 >SB_12310| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 80.2 bits (189), Expect = 4e-15 Identities = 37/46 (80%), Positives = 37/46 (80%) Frame = +1 Query: 619 LAVVLHRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPXPTVA 756 LAVVL RRDWENPGVTQLNRLAAHPPFASWRNSEEA P A Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQCA 74 >SB_3970| Best HMM Match : Drf_FH1 (HMM E-Value=1.2) Length = 558 Score = 80.2 bits (189), Expect = 4e-15 Identities = 37/46 (80%), Positives = 37/46 (80%) Frame = +1 Query: 619 LAVVLHRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPXPTVA 756 LAVVL RRDWENPGVTQLNRLAAHPPFASWRNSEEA P A Sbjct: 512 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQCA 557 >SB_55030| Best HMM Match : Toxin_27 (HMM E-Value=1.2) Length = 110 Score = 80.2 bits (189), Expect = 4e-15 Identities = 38/55 (69%), Positives = 41/55 (74%) Frame = +1 Query: 562 NSRGGPVXXXXXXXXXXXXLAVVLHRRDWENPGVTQLNRLAAHPPFASWRNSEEA 726 ++RG P+ LAVVL RRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 38 SNRGDPLESTCRHASLA--LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 90 Score = 35.5 bits (78), Expect = 0.11 Identities = 14/21 (66%), Positives = 17/21 (80%) Frame = +2 Query: 716 AKRPRTDRPXQQLRSLXGEWQ 778 ++ RTDRP QQLRSL GEW+ Sbjct: 87 SEEARTDRPSQQLRSLNGEWR 107 >SB_41244| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 268 Score = 80.2 bits (189), Expect = 4e-15 Identities = 38/55 (69%), Positives = 40/55 (72%) Frame = +1 Query: 562 NSRGGPVXXXXXXXXXXXXLAVVLHRRDWENPGVTQLNRLAAHPPFASWRNSEEA 726 N +G P+ LAVVL RRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 187 NPKGDPLESTCRHASLA--LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 239 Score = 35.5 bits (78), Expect = 0.11 Identities = 14/21 (66%), Positives = 17/21 (80%) Frame = +2 Query: 716 AKRPRTDRPXQQLRSLXGEWQ 778 ++ RTDRP QQLRSL GEW+ Sbjct: 236 SEEARTDRPSQQLRSLNGEWR 256 >SB_59793| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 79.8 bits (188), Expect = 5e-15 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 619 LAVVLHRRDWENPGVTQLNRLAAHPPFASWRNSEEA 726 LAVVL RRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 35 [lacZ-alpha fragment, 36 aa] 70 Score = 35.1 bits (77), Expect = 0.15 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +2 Query: 716 AKRPRTDRPXQQLRSLXGEW 775 ++ RTDRP QQLRSL GEW Sbjct: 67 SEEARTDRPSQQLRSLNGEW 86 >SB_59635| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 79.8 bits (188), Expect = 5e-15 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 619 LAVVLHRRDWENPGVTQLNRLAAHPPFASWRNSEEA 726 LAVVL RRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 29 [lacZ-alpha fragment, 36 aa] 64 Score = 35.1 bits (77), Expect = 0.15 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +2 Query: 716 AKRPRTDRPXQQLRSLXGEW 775 ++ RTDRP QQLRSL GEW Sbjct: 61 SEEARTDRPSQQLRSLNGEW 80 >SB_59624| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 79.8 bits (188), Expect = 5e-15 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 619 LAVVLHRRDWENPGVTQLNRLAAHPPFASWRNSEEA 726 LAVVL RRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 62 [lacZ-alpha fragment, 36 aa] 97 Score = 35.5 bits (78), Expect = 0.11 Identities = 14/21 (66%), Positives = 17/21 (80%) Frame = +2 Query: 716 AKRPRTDRPXQQLRSLXGEWQ 778 ++ RTDRP QQLRSL GEW+ Sbjct: 94 SEEARTDRPSQQLRSLNGEWR 114 >SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 79.8 bits (188), Expect = 5e-15 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 619 LAVVLHRRDWENPGVTQLNRLAAHPPFASWRNSEEA 726 LAVVL RRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 44 [lacZ-alpha fragment, 36 aa] 79 Score = 35.1 bits (77), Expect = 0.15 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +2 Query: 716 AKRPRTDRPXQQLRSLXGEW 775 ++ RTDRP QQLRSL GEW Sbjct: 76 SEEARTDRPSQQLRSLNGEW 95 >SB_59550| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 79.8 bits (188), Expect = 5e-15 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 619 LAVVLHRRDWENPGVTQLNRLAAHPPFASWRNSEEA 726 LAVVL RRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 36 [lacZ-alpha fragment, 36 aa] 71 Score = 35.1 bits (77), Expect = 0.15 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +2 Query: 716 AKRPRTDRPXQQLRSLXGEW 775 ++ RTDRP QQLRSL GEW Sbjct: 68 SEEARTDRPSQQLRSLNGEW 87 >SB_59504| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 79.8 bits (188), Expect = 5e-15 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 619 LAVVLHRRDWENPGVTQLNRLAAHPPFASWRNSEEA 726 LAVVL RRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 62 [lacZ-alpha fragment, 36 aa] 97 Score = 35.1 bits (77), Expect = 0.15 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +2 Query: 716 AKRPRTDRPXQQLRSLXGEW 775 ++ RTDRP QQLRSL GEW Sbjct: 94 SEEARTDRPSQQLRSLNGEW 113 >SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 79.8 bits (188), Expect = 5e-15 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 619 LAVVLHRRDWENPGVTQLNRLAAHPPFASWRNSEEA 726 LAVVL RRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 67 [lacZ-alpha fragment, 36 aa] 102 Score = 35.1 bits (77), Expect = 0.15 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +2 Query: 716 AKRPRTDRPXQQLRSLXGEW 775 ++ RTDRP QQLRSL GEW Sbjct: 99 SEEARTDRPSQQLRSLNGEW 118 >SB_59286| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 79.8 bits (188), Expect = 5e-15 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 619 LAVVLHRRDWENPGVTQLNRLAAHPPFASWRNSEEA 726 LAVVL RRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 38 [lacZ-alpha fragment, 36 aa] 73 Score = 35.1 bits (77), Expect = 0.15 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +2 Query: 716 AKRPRTDRPXQQLRSLXGEW 775 ++ RTDRP QQLRSL GEW Sbjct: 70 SEEARTDRPSQQLRSLNGEW 89 >SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 79.8 bits (188), Expect = 5e-15 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 619 LAVVLHRRDWENPGVTQLNRLAAHPPFASWRNSEEA 726 LAVVL RRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 58 [lacZ-alpha fragment, 36 aa] 93 Score = 35.1 bits (77), Expect = 0.15 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +2 Query: 716 AKRPRTDRPXQQLRSLXGEW 775 ++ RTDRP QQLRSL GEW Sbjct: 90 SEEARTDRPSQQLRSLNGEW 109 >SB_58987| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 161 Score = 79.8 bits (188), Expect = 5e-15 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 619 LAVVLHRRDWENPGVTQLNRLAAHPPFASWRNSEEA 726 LAVVL RRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 70 [lacZ-alpha fragment, 36 aa] 105 Score = 35.1 bits (77), Expect = 0.15 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +2 Query: 716 AKRPRTDRPXQQLRSLXGEW 775 ++ RTDRP QQLRSL GEW Sbjct: 102 SEEARTDRPSQQLRSLNGEW 121 >SB_58779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 79.8 bits (188), Expect = 5e-15 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 619 LAVVLHRRDWENPGVTQLNRLAAHPPFASWRNSEEA 726 LAVVL RRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 29 [lacZ-alpha fragment, 36 aa] 64 Score = 35.1 bits (77), Expect = 0.15 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +2 Query: 716 AKRPRTDRPXQQLRSLXGEW 775 ++ RTDRP QQLRSL GEW Sbjct: 61 SEEARTDRPSQQLRSLNGEW 80 >SB_58768| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 79.8 bits (188), Expect = 5e-15 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 619 LAVVLHRRDWENPGVTQLNRLAAHPPFASWRNSEEA 726 LAVVL RRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 46 [lacZ-alpha fragment, 36 aa] 81 Score = 35.1 bits (77), Expect = 0.15 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +2 Query: 716 AKRPRTDRPXQQLRSLXGEW 775 ++ RTDRP QQLRSL GEW Sbjct: 78 SEEARTDRPSQQLRSLNGEW 97 >SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 79.8 bits (188), Expect = 5e-15 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 619 LAVVLHRRDWENPGVTQLNRLAAHPPFASWRNSEEA 726 LAVVL RRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 35 [lacZ-alpha fragment, 36 aa] 70 Score = 35.1 bits (77), Expect = 0.15 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +2 Query: 716 AKRPRTDRPXQQLRSLXGEW 775 ++ RTDRP QQLRSL GEW Sbjct: 67 SEEARTDRPSQQLRSLNGEW 86 >SB_58723| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 79.8 bits (188), Expect = 5e-15 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 619 LAVVLHRRDWENPGVTQLNRLAAHPPFASWRNSEEA 726 LAVVL RRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 25 [lacZ-alpha fragment, 36 aa] 60 Score = 35.5 bits (78), Expect = 0.11 Identities = 14/21 (66%), Positives = 17/21 (80%) Frame = +2 Query: 716 AKRPRTDRPXQQLRSLXGEWQ 778 ++ RTDRP QQLRSL GEW+ Sbjct: 57 SEEARTDRPSQQLRSLNGEWR 77 >SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 79.8 bits (188), Expect = 5e-15 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 619 LAVVLHRRDWENPGVTQLNRLAAHPPFASWRNSEEA 726 LAVVL RRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 50 [lacZ-alpha fragment, 36 aa] 85 Score = 35.1 bits (77), Expect = 0.15 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +2 Query: 716 AKRPRTDRPXQQLRSLXGEW 775 ++ RTDRP QQLRSL GEW Sbjct: 82 SEEARTDRPSQQLRSLNGEW 101 >SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 79.8 bits (188), Expect = 5e-15 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 619 LAVVLHRRDWENPGVTQLNRLAAHPPFASWRNSEEA 726 LAVVL RRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 59 [lacZ-alpha fragment, 36 aa] 94 Score = 35.1 bits (77), Expect = 0.15 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +2 Query: 716 AKRPRTDRPXQQLRSLXGEW 775 ++ RTDRP QQLRSL GEW Sbjct: 91 SEEARTDRPSQQLRSLNGEW 110 >SB_58651| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 79.8 bits (188), Expect = 5e-15 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 619 LAVVLHRRDWENPGVTQLNRLAAHPPFASWRNSEEA 726 LAVVL RRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 53 [lacZ-alpha fragment, 36 aa] 88 Score = 35.1 bits (77), Expect = 0.15 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +2 Query: 716 AKRPRTDRPXQQLRSLXGEW 775 ++ RTDRP QQLRSL GEW Sbjct: 85 SEEARTDRPSQQLRSLNGEW 104 >SB_58615| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 160 Score = 79.8 bits (188), Expect = 5e-15 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 619 LAVVLHRRDWENPGVTQLNRLAAHPPFASWRNSEEA 726 LAVVL RRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 69 [lacZ-alpha fragment, 36 aa] 104 Score = 35.1 bits (77), Expect = 0.15 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +2 Query: 716 AKRPRTDRPXQQLRSLXGEW 775 ++ RTDRP QQLRSL GEW Sbjct: 101 SEEARTDRPSQQLRSLNGEW 120 >SB_58535| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 79.8 bits (188), Expect = 5e-15 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 619 LAVVLHRRDWENPGVTQLNRLAAHPPFASWRNSEEA 726 LAVVL RRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 57 [lacZ-alpha fragment, 36 aa] 92 Score = 35.1 bits (77), Expect = 0.15 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +2 Query: 716 AKRPRTDRPXQQLRSLXGEW 775 ++ RTDRP QQLRSL GEW Sbjct: 89 SEEARTDRPSQQLRSLNGEW 108 >SB_58509| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 79.8 bits (188), Expect = 5e-15 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 619 LAVVLHRRDWENPGVTQLNRLAAHPPFASWRNSEEA 726 LAVVL RRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 40 [lacZ-alpha fragment, 36 aa] 75 Score = 35.1 bits (77), Expect = 0.15 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +2 Query: 716 AKRPRTDRPXQQLRSLXGEW 775 ++ RTDRP QQLRSL GEW Sbjct: 72 SEEARTDRPSQQLRSLNGEW 91 >SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) Length = 297 Score = 79.8 bits (188), Expect = 5e-15 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 619 LAVVLHRRDWENPGVTQLNRLAAHPPFASWRNSEEA 726 LAVVL RRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 216 [lacZ-alpha fragment, 36 aa] 251 Score = 35.1 bits (77), Expect = 0.15 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +2 Query: 716 AKRPRTDRPXQQLRSLXGEW 775 ++ RTDRP QQLRSL GEW Sbjct: 248 SEEARTDRPSQQLRSLNGEW 267 >SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 202 Score = 79.8 bits (188), Expect = 5e-15 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 619 LAVVLHRRDWENPGVTQLNRLAAHPPFASWRNSEEA 726 LAVVL RRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 111 [lacZ-alpha fragment, 36 aa] 146 Score = 35.1 bits (77), Expect = 0.15 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +2 Query: 716 AKRPRTDRPXQQLRSLXGEW 775 ++ RTDRP QQLRSL GEW Sbjct: 143 SEEARTDRPSQQLRSLNGEW 162 >SB_58076| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 79.8 bits (188), Expect = 5e-15 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 619 LAVVLHRRDWENPGVTQLNRLAAHPPFASWRNSEEA 726 LAVVL RRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 49 [lacZ-alpha fragment, 36 aa] 84 Score = 35.5 bits (78), Expect = 0.11 Identities = 14/21 (66%), Positives = 17/21 (80%) Frame = +2 Query: 716 AKRPRTDRPXQQLRSLXGEWQ 778 ++ RTDRP QQLRSL GEW+ Sbjct: 81 SEEARTDRPSQQLRSLNGEWR 101 >SB_57885| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 118 Score = 79.8 bits (188), Expect = 5e-15 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 619 LAVVLHRRDWENPGVTQLNRLAAHPPFASWRNSEEA 726 LAVVL RRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 28 [lacZ-alpha fragment, 36 aa] 63 Score = 35.5 bits (78), Expect = 0.11 Identities = 14/21 (66%), Positives = 17/21 (80%) Frame = +2 Query: 716 AKRPRTDRPXQQLRSLXGEWQ 778 ++ RTDRP QQLRSL GEW+ Sbjct: 60 SEEARTDRPSQQLRSLNGEWR 80 >SB_57850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 79.8 bits (188), Expect = 5e-15 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 619 LAVVLHRRDWENPGVTQLNRLAAHPPFASWRNSEEA 726 LAVVL RRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 29 [lacZ-alpha fragment, 36 aa] 64 Score = 35.1 bits (77), Expect = 0.15 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +2 Query: 716 AKRPRTDRPXQQLRSLXGEW 775 ++ RTDRP QQLRSL GEW Sbjct: 61 SEEARTDRPSQQLRSLNGEW 80 >SB_57829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 79.8 bits (188), Expect = 5e-15 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 619 LAVVLHRRDWENPGVTQLNRLAAHPPFASWRNSEEA 726 LAVVL RRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 16 [lacZ-alpha fragment, 36 aa] 51 Score = 35.5 bits (78), Expect = 0.11 Identities = 14/21 (66%), Positives = 17/21 (80%) Frame = +2 Query: 716 AKRPRTDRPXQQLRSLXGEWQ 778 ++ RTDRP QQLRSL GEW+ Sbjct: 48 SEEARTDRPSQQLRSLNGEWR 68 >SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 79.8 bits (188), Expect = 5e-15 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 619 LAVVLHRRDWENPGVTQLNRLAAHPPFASWRNSEEA 726 LAVVL RRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 47 [lacZ-alpha fragment, 36 aa] 82 Score = 35.1 bits (77), Expect = 0.15 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +2 Query: 716 AKRPRTDRPXQQLRSLXGEW 775 ++ RTDRP QQLRSL GEW Sbjct: 79 SEEARTDRPSQQLRSLNGEW 98 >SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) Length = 472 Score = 79.8 bits (188), Expect = 5e-15 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 619 LAVVLHRRDWENPGVTQLNRLAAHPPFASWRNSEEA 726 LAVVL RRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 381 [lacZ-alpha fragment, 36 aa] 416 Score = 35.1 bits (77), Expect = 0.15 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +2 Query: 716 AKRPRTDRPXQQLRSLXGEW 775 ++ RTDRP QQLRSL GEW Sbjct: 413 SEEARTDRPSQQLRSLNGEW 432 >SB_57711| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 79.8 bits (188), Expect = 5e-15 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 619 LAVVLHRRDWENPGVTQLNRLAAHPPFASWRNSEEA 726 LAVVL RRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 29 [lacZ-alpha fragment, 36 aa] 64 Score = 35.1 bits (77), Expect = 0.15 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +2 Query: 716 AKRPRTDRPXQQLRSLXGEW 775 ++ RTDRP QQLRSL GEW Sbjct: 61 SEEARTDRPSQQLRSLNGEW 80 >SB_57692| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 84 Score = 79.8 bits (188), Expect = 5e-15 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 619 LAVVLHRRDWENPGVTQLNRLAAHPPFASWRNSEEA 726 LAVVL RRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 29 [lacZ-alpha fragment, 36 aa] 64 Score = 35.5 bits (78), Expect = 0.11 Identities = 14/21 (66%), Positives = 17/21 (80%) Frame = +2 Query: 716 AKRPRTDRPXQQLRSLXGEWQ 778 ++ RTDRP QQLRSL GEW+ Sbjct: 61 SEEARTDRPSQQLRSLNGEWR 81 >SB_57634| Best HMM Match : EGF_2 (HMM E-Value=0.0014) Length = 198 Score = 79.8 bits (188), Expect = 5e-15 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 619 LAVVLHRRDWENPGVTQLNRLAAHPPFASWRNSEEA 726 LAVVL RRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 107 [lacZ-alpha fragment, 36 aa] 142 Score = 35.1 bits (77), Expect = 0.15 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +2 Query: 716 AKRPRTDRPXQQLRSLXGEW 775 ++ RTDRP QQLRSL GEW Sbjct: 139 SEEARTDRPSQQLRSLNGEW 158 >SB_57403| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 79.8 bits (188), Expect = 5e-15 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 619 LAVVLHRRDWENPGVTQLNRLAAHPPFASWRNSEEA 726 LAVVL RRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 29 [lacZ-alpha fragment, 36 aa] 64 Score = 35.1 bits (77), Expect = 0.15 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +2 Query: 716 AKRPRTDRPXQQLRSLXGEW 775 ++ RTDRP QQLRSL GEW Sbjct: 61 SEEARTDRPSQQLRSLNGEW 80 >SB_57371| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 174 Score = 79.8 bits (188), Expect = 5e-15 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 619 LAVVLHRRDWENPGVTQLNRLAAHPPFASWRNSEEA 726 LAVVL RRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 83 [lacZ-alpha fragment, 36 aa] 118 Score = 35.1 bits (77), Expect = 0.15 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +2 Query: 716 AKRPRTDRPXQQLRSLXGEW 775 ++ RTDRP QQLRSL GEW Sbjct: 115 SEEARTDRPSQQLRSLNGEW 134 >SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 79.8 bits (188), Expect = 5e-15 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 619 LAVVLHRRDWENPGVTQLNRLAAHPPFASWRNSEEA 726 LAVVL RRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 39 [lacZ-alpha fragment, 36 aa] 74 Score = 35.1 bits (77), Expect = 0.15 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +2 Query: 716 AKRPRTDRPXQQLRSLXGEW 775 ++ RTDRP QQLRSL GEW Sbjct: 71 SEEARTDRPSQQLRSLNGEW 90 >SB_57287| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 79.8 bits (188), Expect = 5e-15 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 619 LAVVLHRRDWENPGVTQLNRLAAHPPFASWRNSEEA 726 LAVVL RRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 8 [lacZ-alpha fragment, 36 aa] 43 Score = 35.1 bits (77), Expect = 0.15 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +2 Query: 716 AKRPRTDRPXQQLRSLXGEW 775 ++ RTDRP QQLRSL GEW Sbjct: 40 SEEARTDRPSQQLRSLNGEW 59 >SB_57259| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 79.8 bits (188), Expect = 5e-15 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 619 LAVVLHRRDWENPGVTQLNRLAAHPPFASWRNSEEA 726 LAVVL RRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 18 [lacZ-alpha fragment, 36 aa] 53 Score = 35.5 bits (78), Expect = 0.11 Identities = 14/21 (66%), Positives = 17/21 (80%) Frame = +2 Query: 716 AKRPRTDRPXQQLRSLXGEWQ 778 ++ RTDRP QQLRSL GEW+ Sbjct: 50 SEEARTDRPSQQLRSLNGEWR 70 >SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) Length = 129 Score = 79.8 bits (188), Expect = 5e-15 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 619 LAVVLHRRDWENPGVTQLNRLAAHPPFASWRNSEEA 726 LAVVL RRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 38 [lacZ-alpha fragment, 36 aa] 73 Score = 35.1 bits (77), Expect = 0.15 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +2 Query: 716 AKRPRTDRPXQQLRSLXGEW 775 ++ RTDRP QQLRSL GEW Sbjct: 70 SEEARTDRPSQQLRSLNGEW 89 >SB_57194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 79.8 bits (188), Expect = 5e-15 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 619 LAVVLHRRDWENPGVTQLNRLAAHPPFASWRNSEEA 726 LAVVL RRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 29 [lacZ-alpha fragment, 36 aa] 64 Score = 35.1 bits (77), Expect = 0.15 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +2 Query: 716 AKRPRTDRPXQQLRSLXGEW 775 ++ RTDRP QQLRSL GEW Sbjct: 61 SEEARTDRPSQQLRSLNGEW 80 >SB_57193| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 193 Score = 79.8 bits (188), Expect = 5e-15 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 619 LAVVLHRRDWENPGVTQLNRLAAHPPFASWRNSEEA 726 LAVVL RRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 103 [lacZ-alpha fragment, 36 aa] 138 Score = 35.1 bits (77), Expect = 0.15 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +2 Query: 716 AKRPRTDRPXQQLRSLXGEW 775 ++ RTDRP QQLRSL GEW Sbjct: 135 SEEARTDRPSQQLRSLNGEW 154 >SB_57151| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 79.8 bits (188), Expect = 5e-15 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 619 LAVVLHRRDWENPGVTQLNRLAAHPPFASWRNSEEA 726 LAVVL RRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 45 [lacZ-alpha fragment, 36 aa] 80 Score = 35.1 bits (77), Expect = 0.15 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +2 Query: 716 AKRPRTDRPXQQLRSLXGEW 775 ++ RTDRP QQLRSL GEW Sbjct: 77 SEEARTDRPSQQLRSLNGEW 96 >SB_57135| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 431 Score = 79.8 bits (188), Expect = 5e-15 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 619 LAVVLHRRDWENPGVTQLNRLAAHPPFASWRNSEEA 726 LAVVL RRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 340 [lacZ-alpha fragment, 36 aa] 375 Score = 35.1 bits (77), Expect = 0.15 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +2 Query: 716 AKRPRTDRPXQQLRSLXGEW 775 ++ RTDRP QQLRSL GEW Sbjct: 372 SEEARTDRPSQQLRSLNGEW 391 >SB_57120| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 79.8 bits (188), Expect = 5e-15 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 619 LAVVLHRRDWENPGVTQLNRLAAHPPFASWRNSEEA 726 LAVVL RRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 80 [lacZ-alpha fragment, 36 aa] 115 Score = 35.1 bits (77), Expect = 0.15 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +2 Query: 716 AKRPRTDRPXQQLRSLXGEW 775 ++ RTDRP QQLRSL GEW Sbjct: 112 SEEARTDRPSQQLRSLNGEW 131 >SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 79.8 bits (188), Expect = 5e-15 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 619 LAVVLHRRDWENPGVTQLNRLAAHPPFASWRNSEEA 726 LAVVL RRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 50 [lacZ-alpha fragment, 36 aa] 85 Score = 35.1 bits (77), Expect = 0.15 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +2 Query: 716 AKRPRTDRPXQQLRSLXGEW 775 ++ RTDRP QQLRSL GEW Sbjct: 82 SEEARTDRPSQQLRSLNGEW 101 >SB_56982| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 79.8 bits (188), Expect = 5e-15 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 619 LAVVLHRRDWENPGVTQLNRLAAHPPFASWRNSEEA 726 LAVVL RRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 29 [lacZ-alpha fragment, 36 aa] 64 Score = 35.1 bits (77), Expect = 0.15 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +2 Query: 716 AKRPRTDRPXQQLRSLXGEW 775 ++ RTDRP QQLRSL GEW Sbjct: 61 SEEARTDRPSQQLRSLNGEW 80 >SB_56880| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 79.8 bits (188), Expect = 5e-15 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 619 LAVVLHRRDWENPGVTQLNRLAAHPPFASWRNSEEA 726 LAVVL RRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 16 [lacZ-alpha fragment, 36 aa] 51 Score = 35.5 bits (78), Expect = 0.11 Identities = 14/21 (66%), Positives = 17/21 (80%) Frame = +2 Query: 716 AKRPRTDRPXQQLRSLXGEWQ 778 ++ RTDRP QQLRSL GEW+ Sbjct: 48 SEEARTDRPSQQLRSLNGEWR 68 >SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 79.8 bits (188), Expect = 5e-15 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 619 LAVVLHRRDWENPGVTQLNRLAAHPPFASWRNSEEA 726 LAVVL RRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 59 [lacZ-alpha fragment, 36 aa] 94 Score = 35.1 bits (77), Expect = 0.15 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +2 Query: 716 AKRPRTDRPXQQLRSLXGEW 775 ++ RTDRP QQLRSL GEW Sbjct: 91 SEEARTDRPSQQLRSLNGEW 110 >SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 79.8 bits (188), Expect = 5e-15 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 619 LAVVLHRRDWENPGVTQLNRLAAHPPFASWRNSEEA 726 LAVVL RRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 43 [lacZ-alpha fragment, 36 aa] 78 Score = 35.1 bits (77), Expect = 0.15 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +2 Query: 716 AKRPRTDRPXQQLRSLXGEW 775 ++ RTDRP QQLRSL GEW Sbjct: 75 SEEARTDRPSQQLRSLNGEW 94 >SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 225 Score = 79.8 bits (188), Expect = 5e-15 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 619 LAVVLHRRDWENPGVTQLNRLAAHPPFASWRNSEEA 726 LAVVL RRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 134 [lacZ-alpha fragment, 36 aa] 169 Score = 35.1 bits (77), Expect = 0.15 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +2 Query: 716 AKRPRTDRPXQQLRSLXGEW 775 ++ RTDRP QQLRSL GEW Sbjct: 166 SEEARTDRPSQQLRSLNGEW 185 >SB_56746| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 79.8 bits (188), Expect = 5e-15 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 619 LAVVLHRRDWENPGVTQLNRLAAHPPFASWRNSEEA 726 LAVVL RRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 29 [lacZ-alpha fragment, 36 aa] 64 Score = 35.1 bits (77), Expect = 0.15 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +2 Query: 716 AKRPRTDRPXQQLRSLXGEW 775 ++ RTDRP QQLRSL GEW Sbjct: 61 SEEARTDRPSQQLRSLNGEW 80 >SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 79.8 bits (188), Expect = 5e-15 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 619 LAVVLHRRDWENPGVTQLNRLAAHPPFASWRNSEEA 726 LAVVL RRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 63 [lacZ-alpha fragment, 36 aa] 98 Score = 35.1 bits (77), Expect = 0.15 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +2 Query: 716 AKRPRTDRPXQQLRSLXGEW 775 ++ RTDRP QQLRSL GEW Sbjct: 95 SEEARTDRPSQQLRSLNGEW 114 >SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 79.8 bits (188), Expect = 5e-15 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 619 LAVVLHRRDWENPGVTQLNRLAAHPPFASWRNSEEA 726 LAVVL RRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 39 [lacZ-alpha fragment, 36 aa] 74 Score = 35.1 bits (77), Expect = 0.15 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +2 Query: 716 AKRPRTDRPXQQLRSLXGEW 775 ++ RTDRP QQLRSL GEW Sbjct: 71 SEEARTDRPSQQLRSLNGEW 90 >SB_56676| Best HMM Match : Peptidase_C1 (HMM E-Value=0.0027) Length = 295 Score = 79.8 bits (188), Expect = 5e-15 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 619 LAVVLHRRDWENPGVTQLNRLAAHPPFASWRNSEEA 726 LAVVL RRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 143 [lacZ-alpha fragment, 36 aa] 178 Score = 35.1 bits (77), Expect = 0.15 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +2 Query: 716 AKRPRTDRPXQQLRSLXGEW 775 ++ RTDRP QQLRSL GEW Sbjct: 175 SEEARTDRPSQQLRSLNGEW 194 >SB_56642| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 79.8 bits (188), Expect = 5e-15 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 619 LAVVLHRRDWENPGVTQLNRLAAHPPFASWRNSEEA 726 LAVVL RRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 16 [lacZ-alpha fragment, 36 aa] 51 Score = 35.5 bits (78), Expect = 0.11 Identities = 14/21 (66%), Positives = 17/21 (80%) Frame = +2 Query: 716 AKRPRTDRPXQQLRSLXGEWQ 778 ++ RTDRP QQLRSL GEW+ Sbjct: 48 SEEARTDRPSQQLRSLNGEWR 68 >SB_56581| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 79.8 bits (188), Expect = 5e-15 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 619 LAVVLHRRDWENPGVTQLNRLAAHPPFASWRNSEEA 726 LAVVL RRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 60 [lacZ-alpha fragment, 36 aa] 95 Score = 35.1 bits (77), Expect = 0.15 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +2 Query: 716 AKRPRTDRPXQQLRSLXGEW 775 ++ RTDRP QQLRSL GEW Sbjct: 92 SEEARTDRPSQQLRSLNGEW 111 >SB_56546| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 79.8 bits (188), Expect = 5e-15 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 619 LAVVLHRRDWENPGVTQLNRLAAHPPFASWRNSEEA 726 LAVVL RRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 34 [lacZ-alpha fragment, 36 aa] 69 Score = 35.1 bits (77), Expect = 0.15 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +2 Query: 716 AKRPRTDRPXQQLRSLXGEW 775 ++ RTDRP QQLRSL GEW Sbjct: 66 SEEARTDRPSQQLRSLNGEW 85 >SB_56496| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 163 Score = 79.8 bits (188), Expect = 5e-15 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 619 LAVVLHRRDWENPGVTQLNRLAAHPPFASWRNSEEA 726 LAVVL RRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 73 [lacZ-alpha fragment, 36 aa] 108 Score = 35.1 bits (77), Expect = 0.15 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +2 Query: 716 AKRPRTDRPXQQLRSLXGEW 775 ++ RTDRP QQLRSL GEW Sbjct: 105 SEEARTDRPSQQLRSLNGEW 124 >SB_56428| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 79.8 bits (188), Expect = 5e-15 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 619 LAVVLHRRDWENPGVTQLNRLAAHPPFASWRNSEEA 726 LAVVL RRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 56 [lacZ-alpha fragment, 36 aa] 91 Score = 35.1 bits (77), Expect = 0.15 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +2 Query: 716 AKRPRTDRPXQQLRSLXGEW 775 ++ RTDRP QQLRSL GEW Sbjct: 88 SEEARTDRPSQQLRSLNGEW 107 >SB_56369| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 328 Score = 79.8 bits (188), Expect = 5e-15 Identities = 38/52 (73%), Positives = 41/52 (78%) Frame = -2 Query: 773 IRXSGCATVGKGDRCGASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 618 + +G +G ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 219 LSSTGLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 270 >SB_56281| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 160 Score = 79.8 bits (188), Expect = 5e-15 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 619 LAVVLHRRDWENPGVTQLNRLAAHPPFASWRNSEEA 726 LAVVL RRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 69 [lacZ-alpha fragment, 36 aa] 104 Score = 35.1 bits (77), Expect = 0.15 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +2 Query: 716 AKRPRTDRPXQQLRSLXGEW 775 ++ RTDRP QQLRSL GEW Sbjct: 101 SEEARTDRPSQQLRSLNGEW 120 >SB_56027| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 79.8 bits (188), Expect = 5e-15 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 619 LAVVLHRRDWENPGVTQLNRLAAHPPFASWRNSEEA 726 LAVVL RRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 29 [lacZ-alpha fragment, 36 aa] 64 Score = 35.1 bits (77), Expect = 0.15 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +2 Query: 716 AKRPRTDRPXQQLRSLXGEW 775 ++ RTDRP QQLRSL GEW Sbjct: 61 SEEARTDRPSQQLRSLNGEW 80 >SB_56013| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 539 Score = 79.8 bits (188), Expect = 5e-15 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 619 LAVVLHRRDWENPGVTQLNRLAAHPPFASWRNSEEA 726 LAVVL RRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 256 [lacZ-alpha fragment, 36 aa] 291 Score = 35.1 bits (77), Expect = 0.15 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +2 Query: 716 AKRPRTDRPXQQLRSLXGEW 775 ++ RTDRP QQLRSL GEW Sbjct: 288 SEEARTDRPSQQLRSLNGEW 307 >SB_55938| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 79.8 bits (188), Expect = 5e-15 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 619 LAVVLHRRDWENPGVTQLNRLAAHPPFASWRNSEEA 726 LAVVL RRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 29 [lacZ-alpha fragment, 36 aa] 64 Score = 35.1 bits (77), Expect = 0.15 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +2 Query: 716 AKRPRTDRPXQQLRSLXGEW 775 ++ RTDRP QQLRSL GEW Sbjct: 61 SEEARTDRPSQQLRSLNGEW 80 >SB_55921| Best HMM Match : Aldo_ket_red (HMM E-Value=0.16) Length = 195 Score = 79.8 bits (188), Expect = 5e-15 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 619 LAVVLHRRDWENPGVTQLNRLAAHPPFASWRNSEEA 726 LAVVL RRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 114 [lacZ-alpha fragment, 36 aa] 149 Score = 35.5 bits (78), Expect = 0.11 Identities = 14/21 (66%), Positives = 17/21 (80%) Frame = +2 Query: 716 AKRPRTDRPXQQLRSLXGEWQ 778 ++ RTDRP QQLRSL GEW+ Sbjct: 146 SEEARTDRPSQQLRSLNGEWR 166 >SB_55868| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 79.8 bits (188), Expect = 5e-15 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 619 LAVVLHRRDWENPGVTQLNRLAAHPPFASWRNSEEA 726 LAVVL RRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 50 [lacZ-alpha fragment, 36 aa] 85 Score = 35.1 bits (77), Expect = 0.15 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +2 Query: 716 AKRPRTDRPXQQLRSLXGEW 775 ++ RTDRP QQLRSL GEW Sbjct: 82 SEEARTDRPSQQLRSLNGEW 101 >SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 79.8 bits (188), Expect = 5e-15 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 619 LAVVLHRRDWENPGVTQLNRLAAHPPFASWRNSEEA 726 LAVVL RRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 36 [lacZ-alpha fragment, 36 aa] 71 Score = 35.1 bits (77), Expect = 0.15 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +2 Query: 716 AKRPRTDRPXQQLRSLXGEW 775 ++ RTDRP QQLRSL GEW Sbjct: 68 SEEARTDRPSQQLRSLNGEW 87 >SB_55798| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 79.8 bits (188), Expect = 5e-15 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 619 LAVVLHRRDWENPGVTQLNRLAAHPPFASWRNSEEA 726 LAVVL RRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 37 [lacZ-alpha fragment, 36 aa] 72 Score = 35.1 bits (77), Expect = 0.15 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +2 Query: 716 AKRPRTDRPXQQLRSLXGEW 775 ++ RTDRP QQLRSL GEW Sbjct: 69 SEEARTDRPSQQLRSLNGEW 88 >SB_55789| Best HMM Match : ERG2_Sigma1R (HMM E-Value=3.6e-10) Length = 192 Score = 79.8 bits (188), Expect = 5e-15 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 619 LAVVLHRRDWENPGVTQLNRLAAHPPFASWRNSEEA 726 LAVVL RRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 101 [lacZ-alpha fragment, 36 aa] 136 Score = 35.1 bits (77), Expect = 0.15 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +2 Query: 716 AKRPRTDRPXQQLRSLXGEW 775 ++ RTDRP QQLRSL GEW Sbjct: 133 SEEARTDRPSQQLRSLNGEW 152 >SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 205 Score = 79.8 bits (188), Expect = 5e-15 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 619 LAVVLHRRDWENPGVTQLNRLAAHPPFASWRNSEEA 726 LAVVL RRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 114 [lacZ-alpha fragment, 36 aa] 149 Score = 35.1 bits (77), Expect = 0.15 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +2 Query: 716 AKRPRTDRPXQQLRSLXGEW 775 ++ RTDRP QQLRSL GEW Sbjct: 146 SEEARTDRPSQQLRSLNGEW 165 >SB_55719| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 79.8 bits (188), Expect = 5e-15 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 619 LAVVLHRRDWENPGVTQLNRLAAHPPFASWRNSEEA 726 LAVVL RRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 39 [lacZ-alpha fragment, 36 aa] 74 Score = 35.5 bits (78), Expect = 0.11 Identities = 14/21 (66%), Positives = 17/21 (80%) Frame = +2 Query: 716 AKRPRTDRPXQQLRSLXGEWQ 778 ++ RTDRP QQLRSL GEW+ Sbjct: 71 SEEARTDRPSQQLRSLNGEWR 91 >SB_55703| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 79.8 bits (188), Expect = 5e-15 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 619 LAVVLHRRDWENPGVTQLNRLAAHPPFASWRNSEEA 726 LAVVL RRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 20 [lacZ-alpha fragment, 36 aa] 55 Score = 35.5 bits (78), Expect = 0.11 Identities = 14/21 (66%), Positives = 17/21 (80%) Frame = +2 Query: 716 AKRPRTDRPXQQLRSLXGEWQ 778 ++ RTDRP QQLRSL GEW+ Sbjct: 52 SEEARTDRPSQQLRSLNGEWR 72 >SB_55626| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 79.8 bits (188), Expect = 5e-15 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 619 LAVVLHRRDWENPGVTQLNRLAAHPPFASWRNSEEA 726 LAVVL RRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 58 [lacZ-alpha fragment, 36 aa] 93 Score = 35.1 bits (77), Expect = 0.15 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +2 Query: 716 AKRPRTDRPXQQLRSLXGEW 775 ++ RTDRP QQLRSL GEW Sbjct: 90 SEEARTDRPSQQLRSLNGEW 109 >SB_55592| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 79.8 bits (188), Expect = 5e-15 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 619 LAVVLHRRDWENPGVTQLNRLAAHPPFASWRNSEEA 726 LAVVL RRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 37 [lacZ-alpha fragment, 36 aa] 72 Score = 35.1 bits (77), Expect = 0.15 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +2 Query: 716 AKRPRTDRPXQQLRSLXGEW 775 ++ RTDRP QQLRSL GEW Sbjct: 69 SEEARTDRPSQQLRSLNGEW 88 >SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 79.8 bits (188), Expect = 5e-15 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 619 LAVVLHRRDWENPGVTQLNRLAAHPPFASWRNSEEA 726 LAVVL RRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 34 [lacZ-alpha fragment, 36 aa] 69 Score = 35.1 bits (77), Expect = 0.15 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +2 Query: 716 AKRPRTDRPXQQLRSLXGEW 775 ++ RTDRP QQLRSL GEW Sbjct: 66 SEEARTDRPSQQLRSLNGEW 85 >SB_55288| Best HMM Match : TLD (HMM E-Value=0.00092) Length = 349 Score = 79.8 bits (188), Expect = 5e-15 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 619 LAVVLHRRDWENPGVTQLNRLAAHPPFASWRNSEEA 726 LAVVL RRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 11 [lacZ-alpha fragment, 36 aa] 46 Score = 35.5 bits (78), Expect = 0.11 Identities = 14/21 (66%), Positives = 17/21 (80%) Frame = +2 Query: 716 AKRPRTDRPXQQLRSLXGEWQ 778 ++ RTDRP QQLRSL GEW+ Sbjct: 43 SEEARTDRPSQQLRSLNGEWR 63 >SB_55192| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 74 Score = 79.8 bits (188), Expect = 5e-15 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 619 LAVVLHRRDWENPGVTQLNRLAAHPPFASWRNSEEA 726 LAVVL RRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 19 [lacZ-alpha fragment, 36 aa] 54 Score = 35.5 bits (78), Expect = 0.11 Identities = 14/21 (66%), Positives = 17/21 (80%) Frame = +2 Query: 716 AKRPRTDRPXQQLRSLXGEWQ 778 ++ RTDRP QQLRSL GEW+ Sbjct: 51 SEEARTDRPSQQLRSLNGEWR 71 >SB_55155| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 487 Score = 79.8 bits (188), Expect = 5e-15 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 619 LAVVLHRRDWENPGVTQLNRLAAHPPFASWRNSEEA 726 LAVVL RRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 396 [lacZ-alpha fragment, 36 aa] 431 Score = 35.1 bits (77), Expect = 0.15 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +2 Query: 716 AKRPRTDRPXQQLRSLXGEW 775 ++ RTDRP QQLRSL GEW Sbjct: 428 SEEARTDRPSQQLRSLNGEW 447 >SB_55099| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 79.8 bits (188), Expect = 5e-15 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 619 LAVVLHRRDWENPGVTQLNRLAAHPPFASWRNSEEA 726 LAVVL RRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 45 [lacZ-alpha fragment, 36 aa] 80 Score = 35.1 bits (77), Expect = 0.15 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +2 Query: 716 AKRPRTDRPXQQLRSLXGEW 775 ++ RTDRP QQLRSL GEW Sbjct: 77 SEEARTDRPSQQLRSLNGEW 96 >SB_55072| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 79.8 bits (188), Expect = 5e-15 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 619 LAVVLHRRDWENPGVTQLNRLAAHPPFASWRNSEEA 726 LAVVL RRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 54 [lacZ-alpha fragment, 36 aa] 89 Score = 35.1 bits (77), Expect = 0.15 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +2 Query: 716 AKRPRTDRPXQQLRSLXGEW 775 ++ RTDRP QQLRSL GEW Sbjct: 86 SEEARTDRPSQQLRSLNGEW 105 >SB_55011| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 79.8 bits (188), Expect = 5e-15 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 619 LAVVLHRRDWENPGVTQLNRLAAHPPFASWRNSEEA 726 LAVVL RRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 36 [lacZ-alpha fragment, 36 aa] 71 Score = 35.1 bits (77), Expect = 0.15 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +2 Query: 716 AKRPRTDRPXQQLRSLXGEW 775 ++ RTDRP QQLRSL GEW Sbjct: 68 SEEARTDRPSQQLRSLNGEW 87 >SB_54989| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 79.8 bits (188), Expect = 5e-15 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 619 LAVVLHRRDWENPGVTQLNRLAAHPPFASWRNSEEA 726 LAVVL RRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 29 [lacZ-alpha fragment, 36 aa] 64 Score = 35.1 bits (77), Expect = 0.15 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +2 Query: 716 AKRPRTDRPXQQLRSLXGEW 775 ++ RTDRP QQLRSL GEW Sbjct: 61 SEEARTDRPSQQLRSLNGEW 80 >SB_54840| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 269 Score = 79.8 bits (188), Expect = 5e-15 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 619 LAVVLHRRDWENPGVTQLNRLAAHPPFASWRNSEEA 726 LAVVL RRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 119 [lacZ-alpha fragment, 36 aa] 154 Score = 35.1 bits (77), Expect = 0.15 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +2 Query: 716 AKRPRTDRPXQQLRSLXGEW 775 ++ RTDRP QQLRSL GEW Sbjct: 151 SEEARTDRPSQQLRSLNGEW 170 >SB_54799| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 79.8 bits (188), Expect = 5e-15 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 619 LAVVLHRRDWENPGVTQLNRLAAHPPFASWRNSEEA 726 LAVVL RRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 55 [lacZ-alpha fragment, 36 aa] 90 Score = 35.1 bits (77), Expect = 0.15 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +2 Query: 716 AKRPRTDRPXQQLRSLXGEW 775 ++ RTDRP QQLRSL GEW Sbjct: 87 SEEARTDRPSQQLRSLNGEW 106 >SB_54578| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 79.8 bits (188), Expect = 5e-15 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 619 LAVVLHRRDWENPGVTQLNRLAAHPPFASWRNSEEA 726 LAVVL RRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 65 [lacZ-alpha fragment, 36 aa] 100 Score = 35.1 bits (77), Expect = 0.15 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +2 Query: 716 AKRPRTDRPXQQLRSLXGEW 775 ++ RTDRP QQLRSL GEW Sbjct: 97 SEEARTDRPSQQLRSLNGEW 116 >SB_54508| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 79.8 bits (188), Expect = 5e-15 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 619 LAVVLHRRDWENPGVTQLNRLAAHPPFASWRNSEEA 726 LAVVL RRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 68 [lacZ-alpha fragment, 36 aa] 103 Score = 35.1 bits (77), Expect = 0.15 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +2 Query: 716 AKRPRTDRPXQQLRSLXGEW 775 ++ RTDRP QQLRSL GEW Sbjct: 100 SEEARTDRPSQQLRSLNGEW 119 >SB_54473| Best HMM Match : DLIC (HMM E-Value=0) Length = 1401 Score = 79.8 bits (188), Expect = 5e-15 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 619 LAVVLHRRDWENPGVTQLNRLAAHPPFASWRNSEEA 726 LAVVL RRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 414 [lacZ-alpha fragment, 36 aa] 449 Score = 35.1 bits (77), Expect = 0.15 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +2 Query: 716 AKRPRTDRPXQQLRSLXGEW 775 ++ RTDRP QQLRSL GEW Sbjct: 446 SEEARTDRPSQQLRSLNGEW 465 >SB_54247| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 79.8 bits (188), Expect = 5e-15 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 619 LAVVLHRRDWENPGVTQLNRLAAHPPFASWRNSEEA 726 LAVVL RRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 29 [lacZ-alpha fragment, 36 aa] 64 Score = 35.1 bits (77), Expect = 0.15 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +2 Query: 716 AKRPRTDRPXQQLRSLXGEW 775 ++ RTDRP QQLRSL GEW Sbjct: 61 SEEARTDRPSQQLRSLNGEW 80 >SB_54170| Best HMM Match : Coronavirus_NS4 (HMM E-Value=6.1) Length = 174 Score = 79.8 bits (188), Expect = 5e-15 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 619 LAVVLHRRDWENPGVTQLNRLAAHPPFASWRNSEEA 726 LAVVL RRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 111 [lacZ-alpha fragment, 36 aa] 146 Score = 35.1 bits (77), Expect = 0.15 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +2 Query: 716 AKRPRTDRPXQQLRSLXGEW 775 ++ RTDRP QQLRSL GEW Sbjct: 143 SEEARTDRPSQQLRSLNGEW 162 >SB_54136| Best HMM Match : YbgT_YccB (HMM E-Value=3) Length = 157 Score = 79.8 bits (188), Expect = 5e-15 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 619 LAVVLHRRDWENPGVTQLNRLAAHPPFASWRNSEEA 726 LAVVL RRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 67 [lacZ-alpha fragment, 36 aa] 102 Score = 35.1 bits (77), Expect = 0.15 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +2 Query: 716 AKRPRTDRPXQQLRSLXGEW 775 ++ RTDRP QQLRSL GEW Sbjct: 99 SEEARTDRPSQQLRSLNGEW 118 >SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 79.8 bits (188), Expect = 5e-15 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 619 LAVVLHRRDWENPGVTQLNRLAAHPPFASWRNSEEA 726 LAVVL RRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 56 [lacZ-alpha fragment, 36 aa] 91 Score = 35.1 bits (77), Expect = 0.15 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +2 Query: 716 AKRPRTDRPXQQLRSLXGEW 775 ++ RTDRP QQLRSL GEW Sbjct: 88 SEEARTDRPSQQLRSLNGEW 107 >SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) Length = 137 Score = 79.8 bits (188), Expect = 5e-15 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 619 LAVVLHRRDWENPGVTQLNRLAAHPPFASWRNSEEA 726 LAVVL RRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 46 [lacZ-alpha fragment, 36 aa] 81 Score = 35.1 bits (77), Expect = 0.15 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +2 Query: 716 AKRPRTDRPXQQLRSLXGEW 775 ++ RTDRP QQLRSL GEW Sbjct: 78 SEEARTDRPSQQLRSLNGEW 97 >SB_53753| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 252 Score = 79.8 bits (188), Expect = 5e-15 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 619 LAVVLHRRDWENPGVTQLNRLAAHPPFASWRNSEEA 726 LAVVL RRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 161 [lacZ-alpha fragment, 36 aa] 196 Score = 35.1 bits (77), Expect = 0.15 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +2 Query: 716 AKRPRTDRPXQQLRSLXGEW 775 ++ RTDRP QQLRSL GEW Sbjct: 193 SEEARTDRPSQQLRSLNGEW 212 >SB_53666| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 79.8 bits (188), Expect = 5e-15 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 619 LAVVLHRRDWENPGVTQLNRLAAHPPFASWRNSEEA 726 LAVVL RRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 29 [lacZ-alpha fragment, 36 aa] 64 Score = 35.1 bits (77), Expect = 0.15 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +2 Query: 716 AKRPRTDRPXQQLRSLXGEW 775 ++ RTDRP QQLRSL GEW Sbjct: 61 SEEARTDRPSQQLRSLNGEW 80 >SB_53625| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 79.8 bits (188), Expect = 5e-15 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 619 LAVVLHRRDWENPGVTQLNRLAAHPPFASWRNSEEA 726 LAVVL RRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 65 [lacZ-alpha fragment, 36 aa] 100 Score = 35.1 bits (77), Expect = 0.15 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +2 Query: 716 AKRPRTDRPXQQLRSLXGEW 775 ++ RTDRP QQLRSL GEW Sbjct: 97 SEEARTDRPSQQLRSLNGEW 116 >SB_53515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 79.8 bits (188), Expect = 5e-15 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 619 LAVVLHRRDWENPGVTQLNRLAAHPPFASWRNSEEA 726 LAVVL RRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 52 [lacZ-alpha fragment, 36 aa] 87 Score = 35.1 bits (77), Expect = 0.15 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +2 Query: 716 AKRPRTDRPXQQLRSLXGEW 775 ++ RTDRP QQLRSL GEW Sbjct: 84 SEEARTDRPSQQLRSLNGEW 103 >SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 79.8 bits (188), Expect = 5e-15 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 619 LAVVLHRRDWENPGVTQLNRLAAHPPFASWRNSEEA 726 LAVVL RRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 88 [lacZ-alpha fragment, 36 aa] 123 Score = 35.5 bits (78), Expect = 0.11 Identities = 14/21 (66%), Positives = 17/21 (80%) Frame = +2 Query: 716 AKRPRTDRPXQQLRSLXGEWQ 778 ++ RTDRP QQLRSL GEW+ Sbjct: 120 SEEARTDRPSQQLRSLNGEWR 140 >SB_53366| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 79.8 bits (188), Expect = 5e-15 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 619 LAVVLHRRDWENPGVTQLNRLAAHPPFASWRNSEEA 726 LAVVL RRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 37 [lacZ-alpha fragment, 36 aa] 72 Score = 35.5 bits (78), Expect = 0.11 Identities = 14/21 (66%), Positives = 17/21 (80%) Frame = +2 Query: 716 AKRPRTDRPXQQLRSLXGEWQ 778 ++ RTDRP QQLRSL GEW+ Sbjct: 69 SEEARTDRPSQQLRSLNGEWR 89 >SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 79.8 bits (188), Expect = 5e-15 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 619 LAVVLHRRDWENPGVTQLNRLAAHPPFASWRNSEEA 726 LAVVL RRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 63 [lacZ-alpha fragment, 36 aa] 98 Score = 35.1 bits (77), Expect = 0.15 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +2 Query: 716 AKRPRTDRPXQQLRSLXGEW 775 ++ RTDRP QQLRSL GEW Sbjct: 95 SEEARTDRPSQQLRSLNGEW 114 >SB_53231| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 79.8 bits (188), Expect = 5e-15 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 619 LAVVLHRRDWENPGVTQLNRLAAHPPFASWRNSEEA 726 LAVVL RRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 29 [lacZ-alpha fragment, 36 aa] 64 Score = 35.1 bits (77), Expect = 0.15 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +2 Query: 716 AKRPRTDRPXQQLRSLXGEW 775 ++ RTDRP QQLRSL GEW Sbjct: 61 SEEARTDRPSQQLRSLNGEW 80 >SB_53118| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 79.8 bits (188), Expect = 5e-15 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 619 LAVVLHRRDWENPGVTQLNRLAAHPPFASWRNSEEA 726 LAVVL RRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 29 [lacZ-alpha fragment, 36 aa] 64 Score = 35.1 bits (77), Expect = 0.15 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +2 Query: 716 AKRPRTDRPXQQLRSLXGEW 775 ++ RTDRP QQLRSL GEW Sbjct: 61 SEEARTDRPSQQLRSLNGEW 80 >SB_52850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 79.8 bits (188), Expect = 5e-15 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 619 LAVVLHRRDWENPGVTQLNRLAAHPPFASWRNSEEA 726 LAVVL RRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 42 [lacZ-alpha fragment, 36 aa] 77 Score = 35.1 bits (77), Expect = 0.15 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +2 Query: 716 AKRPRTDRPXQQLRSLXGEW 775 ++ RTDRP QQLRSL GEW Sbjct: 74 SEEARTDRPSQQLRSLNGEW 93 >SB_52844| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 79.8 bits (188), Expect = 5e-15 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 619 LAVVLHRRDWENPGVTQLNRLAAHPPFASWRNSEEA 726 LAVVL RRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 29 [lacZ-alpha fragment, 36 aa] 64 Score = 35.1 bits (77), Expect = 0.15 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +2 Query: 716 AKRPRTDRPXQQLRSLXGEW 775 ++ RTDRP QQLRSL GEW Sbjct: 61 SEEARTDRPSQQLRSLNGEW 80 >SB_52789| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 300 Score = 79.8 bits (188), Expect = 5e-15 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 619 LAVVLHRRDWENPGVTQLNRLAAHPPFASWRNSEEA 726 LAVVL RRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 185 [lacZ-alpha fragment, 36 aa] 220 Score = 35.1 bits (77), Expect = 0.15 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +2 Query: 716 AKRPRTDRPXQQLRSLXGEW 775 ++ RTDRP QQLRSL GEW Sbjct: 217 SEEARTDRPSQQLRSLNGEW 236 >SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 79.8 bits (188), Expect = 5e-15 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 619 LAVVLHRRDWENPGVTQLNRLAAHPPFASWRNSEEA 726 LAVVL RRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 34 [lacZ-alpha fragment, 36 aa] 69 Score = 35.1 bits (77), Expect = 0.15 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +2 Query: 716 AKRPRTDRPXQQLRSLXGEW 775 ++ RTDRP QQLRSL GEW Sbjct: 66 SEEARTDRPSQQLRSLNGEW 85 >SB_52731| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 79 Score = 79.8 bits (188), Expect = 5e-15 Identities = 34/36 (94%), Positives = 34/36 (94%) Frame = -1 Query: 774 HSPXRLRNCWXGRSVRGLFAITPAGERGMCCKAIKL 667 HSP RLRNCW GRSVRGLFAITPAGERGMCCKAIKL Sbjct: 43 HSPFRLRNCWEGRSVRGLFAITPAGERGMCCKAIKL 78 >SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 79.8 bits (188), Expect = 5e-15 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 619 LAVVLHRRDWENPGVTQLNRLAAHPPFASWRNSEEA 726 LAVVL RRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 40 [lacZ-alpha fragment, 36 aa] 75 Score = 35.1 bits (77), Expect = 0.15 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +2 Query: 716 AKRPRTDRPXQQLRSLXGEW 775 ++ RTDRP QQLRSL GEW Sbjct: 72 SEEARTDRPSQQLRSLNGEW 91 >SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 79.8 bits (188), Expect = 5e-15 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 619 LAVVLHRRDWENPGVTQLNRLAAHPPFASWRNSEEA 726 LAVVL RRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 54 [lacZ-alpha fragment, 36 aa] 89 Score = 35.1 bits (77), Expect = 0.15 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +2 Query: 716 AKRPRTDRPXQQLRSLXGEW 775 ++ RTDRP QQLRSL GEW Sbjct: 86 SEEARTDRPSQQLRSLNGEW 105 >SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) Length = 142 Score = 79.8 bits (188), Expect = 5e-15 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 619 LAVVLHRRDWENPGVTQLNRLAAHPPFASWRNSEEA 726 LAVVL RRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 51 [lacZ-alpha fragment, 36 aa] 86 Score = 35.1 bits (77), Expect = 0.15 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +2 Query: 716 AKRPRTDRPXQQLRSLXGEW 775 ++ RTDRP QQLRSL GEW Sbjct: 83 SEEARTDRPSQQLRSLNGEW 102 >SB_52427| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 79.8 bits (188), Expect = 5e-15 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 619 LAVVLHRRDWENPGVTQLNRLAAHPPFASWRNSEEA 726 LAVVL RRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 29 [lacZ-alpha fragment, 36 aa] 64 Score = 35.1 bits (77), Expect = 0.15 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +2 Query: 716 AKRPRTDRPXQQLRSLXGEW 775 ++ RTDRP QQLRSL GEW Sbjct: 61 SEEARTDRPSQQLRSLNGEW 80 >SB_52394| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 79.8 bits (188), Expect = 5e-15 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 619 LAVVLHRRDWENPGVTQLNRLAAHPPFASWRNSEEA 726 LAVVL RRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 34 [lacZ-alpha fragment, 36 aa] 69 Score = 35.1 bits (77), Expect = 0.15 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +2 Query: 716 AKRPRTDRPXQQLRSLXGEW 775 ++ RTDRP QQLRSL GEW Sbjct: 66 SEEARTDRPSQQLRSLNGEW 85 >SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 79.8 bits (188), Expect = 5e-15 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 619 LAVVLHRRDWENPGVTQLNRLAAHPPFASWRNSEEA 726 LAVVL RRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 35 [lacZ-alpha fragment, 36 aa] 70 Score = 35.1 bits (77), Expect = 0.15 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +2 Query: 716 AKRPRTDRPXQQLRSLXGEW 775 ++ RTDRP QQLRSL GEW Sbjct: 67 SEEARTDRPSQQLRSLNGEW 86 >SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 79.8 bits (188), Expect = 5e-15 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 619 LAVVLHRRDWENPGVTQLNRLAAHPPFASWRNSEEA 726 LAVVL RRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 49 [lacZ-alpha fragment, 36 aa] 84 Score = 35.1 bits (77), Expect = 0.15 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +2 Query: 716 AKRPRTDRPXQQLRSLXGEW 775 ++ RTDRP QQLRSL GEW Sbjct: 81 SEEARTDRPSQQLRSLNGEW 100 >SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 79.8 bits (188), Expect = 5e-15 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 619 LAVVLHRRDWENPGVTQLNRLAAHPPFASWRNSEEA 726 LAVVL RRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 39 [lacZ-alpha fragment, 36 aa] 74 Score = 35.1 bits (77), Expect = 0.15 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +2 Query: 716 AKRPRTDRPXQQLRSLXGEW 775 ++ RTDRP QQLRSL GEW Sbjct: 71 SEEARTDRPSQQLRSLNGEW 90 >SB_52260| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 79.8 bits (188), Expect = 5e-15 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 619 LAVVLHRRDWENPGVTQLNRLAAHPPFASWRNSEEA 726 LAVVL RRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 29 [lacZ-alpha fragment, 36 aa] 64 Score = 35.1 bits (77), Expect = 0.15 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +2 Query: 716 AKRPRTDRPXQQLRSLXGEW 775 ++ RTDRP QQLRSL GEW Sbjct: 61 SEEARTDRPSQQLRSLNGEW 80 >SB_52253| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 79.8 bits (188), Expect = 5e-15 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 619 LAVVLHRRDWENPGVTQLNRLAAHPPFASWRNSEEA 726 LAVVL RRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 41 [lacZ-alpha fragment, 36 aa] 76 Score = 35.1 bits (77), Expect = 0.15 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +2 Query: 716 AKRPRTDRPXQQLRSLXGEW 775 ++ RTDRP QQLRSL GEW Sbjct: 73 SEEARTDRPSQQLRSLNGEW 92 >SB_52161| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 174 Score = 79.8 bits (188), Expect = 5e-15 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 619 LAVVLHRRDWENPGVTQLNRLAAHPPFASWRNSEEA 726 LAVVL RRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 84 [lacZ-alpha fragment, 36 aa] 119 Score = 35.1 bits (77), Expect = 0.15 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +2 Query: 716 AKRPRTDRPXQQLRSLXGEW 775 ++ RTDRP QQLRSL GEW Sbjct: 116 SEEARTDRPSQQLRSLNGEW 135 >SB_52130| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 79.8 bits (188), Expect = 5e-15 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 619 LAVVLHRRDWENPGVTQLNRLAAHPPFASWRNSEEA 726 LAVVL RRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 22 [lacZ-alpha fragment, 36 aa] 57 Score = 35.5 bits (78), Expect = 0.11 Identities = 14/21 (66%), Positives = 17/21 (80%) Frame = +2 Query: 716 AKRPRTDRPXQQLRSLXGEWQ 778 ++ RTDRP QQLRSL GEW+ Sbjct: 54 SEEARTDRPSQQLRSLNGEWR 74 >SB_52086| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 79.8 bits (188), Expect = 5e-15 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 619 LAVVLHRRDWENPGVTQLNRLAAHPPFASWRNSEEA 726 LAVVL RRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 29 [lacZ-alpha fragment, 36 aa] 64 Score = 35.1 bits (77), Expect = 0.15 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +2 Query: 716 AKRPRTDRPXQQLRSLXGEW 775 ++ RTDRP QQLRSL GEW Sbjct: 61 SEEARTDRPSQQLRSLNGEW 80 >SB_52085| Best HMM Match : TIL (HMM E-Value=2.5) Length = 234 Score = 79.8 bits (188), Expect = 5e-15 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 619 LAVVLHRRDWENPGVTQLNRLAAHPPFASWRNSEEA 726 LAVVL RRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 153 [lacZ-alpha fragment, 36 aa] 188 Score = 35.5 bits (78), Expect = 0.11 Identities = 14/21 (66%), Positives = 17/21 (80%) Frame = +2 Query: 716 AKRPRTDRPXQQLRSLXGEWQ 778 ++ RTDRP QQLRSL GEW+ Sbjct: 185 SEEARTDRPSQQLRSLNGEWR 205 >SB_51989| Best HMM Match : Extensin_2 (HMM E-Value=0.29) Length = 473 Score = 79.8 bits (188), Expect = 5e-15 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 619 LAVVLHRRDWENPGVTQLNRLAAHPPFASWRNSEEA 726 LAVVL RRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 340 [lacZ-alpha fragment, 36 aa] 375 Score = 35.1 bits (77), Expect = 0.15 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +2 Query: 716 AKRPRTDRPXQQLRSLXGEW 775 ++ RTDRP QQLRSL GEW Sbjct: 372 SEEARTDRPSQQLRSLNGEW 391 >SB_51638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 79.8 bits (188), Expect = 5e-15 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 619 LAVVLHRRDWENPGVTQLNRLAAHPPFASWRNSEEA 726 LAVVL RRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 57 [lacZ-alpha fragment, 36 aa] 92 Score = 35.5 bits (78), Expect = 0.11 Identities = 14/21 (66%), Positives = 17/21 (80%) Frame = +2 Query: 716 AKRPRTDRPXQQLRSLXGEWQ 778 ++ RTDRP QQLRSL GEW+ Sbjct: 89 SEEARTDRPSQQLRSLNGEWR 109 >SB_51529| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 79.8 bits (188), Expect = 5e-15 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 619 LAVVLHRRDWENPGVTQLNRLAAHPPFASWRNSEEA 726 LAVVL RRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 21 [lacZ-alpha fragment, 36 aa] 56 Score = 35.5 bits (78), Expect = 0.11 Identities = 14/21 (66%), Positives = 17/21 (80%) Frame = +2 Query: 716 AKRPRTDRPXQQLRSLXGEWQ 778 ++ RTDRP QQLRSL GEW+ Sbjct: 53 SEEARTDRPSQQLRSLNGEWR 73 >SB_51427| Best HMM Match : DUF855 (HMM E-Value=4) Length = 301 Score = 79.8 bits (188), Expect = 5e-15 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 619 LAVVLHRRDWENPGVTQLNRLAAHPPFASWRNSEEA 726 LAVVL RRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 109 [lacZ-alpha fragment, 36 aa] 144 Score = 35.1 bits (77), Expect = 0.15 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +2 Query: 716 AKRPRTDRPXQQLRSLXGEW 775 ++ RTDRP QQLRSL GEW Sbjct: 141 SEEARTDRPSQQLRSLNGEW 160 >SB_51409| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 79.8 bits (188), Expect = 5e-15 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 619 LAVVLHRRDWENPGVTQLNRLAAHPPFASWRNSEEA 726 LAVVL RRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 29 [lacZ-alpha fragment, 36 aa] 64 Score = 35.1 bits (77), Expect = 0.15 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +2 Query: 716 AKRPRTDRPXQQLRSLXGEW 775 ++ RTDRP QQLRSL GEW Sbjct: 61 SEEARTDRPSQQLRSLNGEW 80 >SB_51320| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 79.8 bits (188), Expect = 5e-15 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 619 LAVVLHRRDWENPGVTQLNRLAAHPPFASWRNSEEA 726 LAVVL RRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 29 [lacZ-alpha fragment, 36 aa] 64 Score = 35.1 bits (77), Expect = 0.15 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +2 Query: 716 AKRPRTDRPXQQLRSLXGEW 775 ++ RTDRP QQLRSL GEW Sbjct: 61 SEEARTDRPSQQLRSLNGEW 80 >SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 79.8 bits (188), Expect = 5e-15 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 619 LAVVLHRRDWENPGVTQLNRLAAHPPFASWRNSEEA 726 LAVVL RRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 86 [lacZ-alpha fragment, 36 aa] 121 Score = 35.1 bits (77), Expect = 0.15 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +2 Query: 716 AKRPRTDRPXQQLRSLXGEW 775 ++ RTDRP QQLRSL GEW Sbjct: 118 SEEARTDRPSQQLRSLNGEW 137 >SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 79.8 bits (188), Expect = 5e-15 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 619 LAVVLHRRDWENPGVTQLNRLAAHPPFASWRNSEEA 726 LAVVL RRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 36 [lacZ-alpha fragment, 36 aa] 71 Score = 35.1 bits (77), Expect = 0.15 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +2 Query: 716 AKRPRTDRPXQQLRSLXGEW 775 ++ RTDRP QQLRSL GEW Sbjct: 68 SEEARTDRPSQQLRSLNGEW 87 >SB_50850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 79.8 bits (188), Expect = 5e-15 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 619 LAVVLHRRDWENPGVTQLNRLAAHPPFASWRNSEEA 726 LAVVL RRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 60 [lacZ-alpha fragment, 36 aa] 95 Score = 35.5 bits (78), Expect = 0.11 Identities = 14/21 (66%), Positives = 17/21 (80%) Frame = +2 Query: 716 AKRPRTDRPXQQLRSLXGEWQ 778 ++ RTDRP QQLRSL GEW+ Sbjct: 92 SEEARTDRPSQQLRSLNGEWR 112 >SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) Length = 385 Score = 79.8 bits (188), Expect = 5e-15 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 619 LAVVLHRRDWENPGVTQLNRLAAHPPFASWRNSEEA 726 LAVVL RRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 294 [lacZ-alpha fragment, 36 aa] 329 Score = 35.1 bits (77), Expect = 0.15 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +2 Query: 716 AKRPRTDRPXQQLRSLXGEW 775 ++ RTDRP QQLRSL GEW Sbjct: 326 SEEARTDRPSQQLRSLNGEW 345 >SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 79.8 bits (188), Expect = 5e-15 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 619 LAVVLHRRDWENPGVTQLNRLAAHPPFASWRNSEEA 726 LAVVL RRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 57 [lacZ-alpha fragment, 36 aa] 92 Score = 35.1 bits (77), Expect = 0.15 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +2 Query: 716 AKRPRTDRPXQQLRSLXGEW 775 ++ RTDRP QQLRSL GEW Sbjct: 89 SEEARTDRPSQQLRSLNGEW 108 >SB_50493| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 79.8 bits (188), Expect = 5e-15 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 619 LAVVLHRRDWENPGVTQLNRLAAHPPFASWRNSEEA 726 LAVVL RRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 58 [lacZ-alpha fragment, 36 aa] 93 Score = 35.1 bits (77), Expect = 0.15 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +2 Query: 716 AKRPRTDRPXQQLRSLXGEW 775 ++ RTDRP QQLRSL GEW Sbjct: 90 SEEARTDRPSQQLRSLNGEW 109 >SB_50473| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 79.8 bits (188), Expect = 5e-15 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 619 LAVVLHRRDWENPGVTQLNRLAAHPPFASWRNSEEA 726 LAVVL RRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 16 [lacZ-alpha fragment, 36 aa] 51 Score = 35.5 bits (78), Expect = 0.11 Identities = 14/21 (66%), Positives = 17/21 (80%) Frame = +2 Query: 716 AKRPRTDRPXQQLRSLXGEWQ 778 ++ RTDRP QQLRSL GEW+ Sbjct: 48 SEEARTDRPSQQLRSLNGEWR 68 >SB_50417| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 79.8 bits (188), Expect = 5e-15 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 619 LAVVLHRRDWENPGVTQLNRLAAHPPFASWRNSEEA 726 LAVVL RRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 36 [lacZ-alpha fragment, 36 aa] 71 Score = 35.1 bits (77), Expect = 0.15 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +2 Query: 716 AKRPRTDRPXQQLRSLXGEW 775 ++ RTDRP QQLRSL GEW Sbjct: 68 SEEARTDRPSQQLRSLNGEW 87 >SB_50270| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 857 Score = 79.8 bits (188), Expect = 5e-15 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 619 LAVVLHRRDWENPGVTQLNRLAAHPPFASWRNSEEA 726 LAVVL RRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 411 [lacZ-alpha fragment, 36 aa] 446 Score = 35.1 bits (77), Expect = 0.15 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +2 Query: 716 AKRPRTDRPXQQLRSLXGEW 775 ++ RTDRP QQLRSL GEW Sbjct: 443 SEEARTDRPSQQLRSLNGEW 462 >SB_50195| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 186 Score = 79.8 bits (188), Expect = 5e-15 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 619 LAVVLHRRDWENPGVTQLNRLAAHPPFASWRNSEEA 726 LAVVL RRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 95 [lacZ-alpha fragment, 36 aa] 130 Score = 35.1 bits (77), Expect = 0.15 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +2 Query: 716 AKRPRTDRPXQQLRSLXGEW 775 ++ RTDRP QQLRSL GEW Sbjct: 127 SEEARTDRPSQQLRSLNGEW 146 >SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 79.8 bits (188), Expect = 5e-15 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 619 LAVVLHRRDWENPGVTQLNRLAAHPPFASWRNSEEA 726 LAVVL RRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 51 [lacZ-alpha fragment, 36 aa] 86 Score = 35.1 bits (77), Expect = 0.15 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +2 Query: 716 AKRPRTDRPXQQLRSLXGEW 775 ++ RTDRP QQLRSL GEW Sbjct: 83 SEEARTDRPSQQLRSLNGEW 102 >SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 79.8 bits (188), Expect = 5e-15 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 619 LAVVLHRRDWENPGVTQLNRLAAHPPFASWRNSEEA 726 LAVVL RRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 43 [lacZ-alpha fragment, 36 aa] 78 Score = 35.1 bits (77), Expect = 0.15 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +2 Query: 716 AKRPRTDRPXQQLRSLXGEW 775 ++ RTDRP QQLRSL GEW Sbjct: 75 SEEARTDRPSQQLRSLNGEW 94 >SB_49896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 184 Score = 79.8 bits (188), Expect = 5e-15 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 619 LAVVLHRRDWENPGVTQLNRLAAHPPFASWRNSEEA 726 LAVVL RRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 93 [lacZ-alpha fragment, 36 aa] 128 Score = 35.1 bits (77), Expect = 0.15 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +2 Query: 716 AKRPRTDRPXQQLRSLXGEW 775 ++ RTDRP QQLRSL GEW Sbjct: 125 SEEARTDRPSQQLRSLNGEW 144 >SB_49839| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 79.8 bits (188), Expect = 5e-15 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 619 LAVVLHRRDWENPGVTQLNRLAAHPPFASWRNSEEA 726 LAVVL RRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 43 [lacZ-alpha fragment, 36 aa] 78 Score = 35.1 bits (77), Expect = 0.15 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +2 Query: 716 AKRPRTDRPXQQLRSLXGEW 775 ++ RTDRP QQLRSL GEW Sbjct: 75 SEEARTDRPSQQLRSLNGEW 94 >SB_49814| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 302 Score = 79.8 bits (188), Expect = 5e-15 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 619 LAVVLHRRDWENPGVTQLNRLAAHPPFASWRNSEEA 726 LAVVL RRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 211 [lacZ-alpha fragment, 36 aa] 246 Score = 35.1 bits (77), Expect = 0.15 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +2 Query: 716 AKRPRTDRPXQQLRSLXGEW 775 ++ RTDRP QQLRSL GEW Sbjct: 243 SEEARTDRPSQQLRSLNGEW 262 >SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 79.8 bits (188), Expect = 5e-15 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 619 LAVVLHRRDWENPGVTQLNRLAAHPPFASWRNSEEA 726 LAVVL RRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 43 [lacZ-alpha fragment, 36 aa] 78 Score = 35.1 bits (77), Expect = 0.15 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +2 Query: 716 AKRPRTDRPXQQLRSLXGEW 775 ++ RTDRP QQLRSL GEW Sbjct: 75 SEEARTDRPSQQLRSLNGEW 94 >SB_49644| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1615 Score = 79.8 bits (188), Expect = 5e-15 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 619 LAVVLHRRDWENPGVTQLNRLAAHPPFASWRNSEEA 726 LAVVL RRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 213 [lacZ-alpha fragment, 36 aa] 248 Score = 35.5 bits (78), Expect = 0.11 Identities = 14/21 (66%), Positives = 17/21 (80%) Frame = +2 Query: 716 AKRPRTDRPXQQLRSLXGEWQ 778 ++ RTDRP QQLRSL GEW+ Sbjct: 245 SEEARTDRPSQQLRSLNGEWR 265 >SB_49542| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 88 Score = 79.8 bits (188), Expect = 5e-15 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 619 LAVVLHRRDWENPGVTQLNRLAAHPPFASWRNSEEA 726 LAVVL RRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 33 [lacZ-alpha fragment, 36 aa] 68 Score = 35.5 bits (78), Expect = 0.11 Identities = 14/21 (66%), Positives = 17/21 (80%) Frame = +2 Query: 716 AKRPRTDRPXQQLRSLXGEWQ 778 ++ RTDRP QQLRSL GEW+ Sbjct: 65 SEEARTDRPSQQLRSLNGEWR 85 >SB_49530| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 79.8 bits (188), Expect = 5e-15 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 619 LAVVLHRRDWENPGVTQLNRLAAHPPFASWRNSEEA 726 LAVVL RRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 29 [lacZ-alpha fragment, 36 aa] 64 Score = 35.1 bits (77), Expect = 0.15 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +2 Query: 716 AKRPRTDRPXQQLRSLXGEW 775 ++ RTDRP QQLRSL GEW Sbjct: 61 SEEARTDRPSQQLRSLNGEW 80 >SB_49495| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 118 Score = 79.8 bits (188), Expect = 5e-15 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 619 LAVVLHRRDWENPGVTQLNRLAAHPPFASWRNSEEA 726 LAVVL RRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 48 [lacZ-alpha fragment, 36 aa] 83 Score = 35.5 bits (78), Expect = 0.11 Identities = 14/21 (66%), Positives = 17/21 (80%) Frame = +2 Query: 716 AKRPRTDRPXQQLRSLXGEWQ 778 ++ RTDRP QQLRSL GEW+ Sbjct: 80 SEEARTDRPSQQLRSLNGEWR 100 >SB_49465| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 79.8 bits (188), Expect = 5e-15 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 619 LAVVLHRRDWENPGVTQLNRLAAHPPFASWRNSEEA 726 LAVVL RRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 38 [lacZ-alpha fragment, 36 aa] 73 Score = 35.1 bits (77), Expect = 0.15 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +2 Query: 716 AKRPRTDRPXQQLRSLXGEW 775 ++ RTDRP QQLRSL GEW Sbjct: 70 SEEARTDRPSQQLRSLNGEW 89 >SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 79.8 bits (188), Expect = 5e-15 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 619 LAVVLHRRDWENPGVTQLNRLAAHPPFASWRNSEEA 726 LAVVL RRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 43 [lacZ-alpha fragment, 36 aa] 78 Score = 35.1 bits (77), Expect = 0.15 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +2 Query: 716 AKRPRTDRPXQQLRSLXGEW 775 ++ RTDRP QQLRSL GEW Sbjct: 75 SEEARTDRPSQQLRSLNGEW 94 >SB_49395| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 238 Score = 79.8 bits (188), Expect = 5e-15 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 619 LAVVLHRRDWENPGVTQLNRLAAHPPFASWRNSEEA 726 LAVVL RRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 147 [lacZ-alpha fragment, 36 aa] 182 Score = 35.1 bits (77), Expect = 0.15 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +2 Query: 716 AKRPRTDRPXQQLRSLXGEW 775 ++ RTDRP QQLRSL GEW Sbjct: 179 SEEARTDRPSQQLRSLNGEW 198 >SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 79.8 bits (188), Expect = 5e-15 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 619 LAVVLHRRDWENPGVTQLNRLAAHPPFASWRNSEEA 726 LAVVL RRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 45 [lacZ-alpha fragment, 36 aa] 80 Score = 35.1 bits (77), Expect = 0.15 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +2 Query: 716 AKRPRTDRPXQQLRSLXGEW 775 ++ RTDRP QQLRSL GEW Sbjct: 77 SEEARTDRPSQQLRSLNGEW 96 >SB_49211| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 79.8 bits (188), Expect = 5e-15 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 619 LAVVLHRRDWENPGVTQLNRLAAHPPFASWRNSEEA 726 LAVVL RRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 35 [lacZ-alpha fragment, 36 aa] 70 Score = 35.1 bits (77), Expect = 0.15 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +2 Query: 716 AKRPRTDRPXQQLRSLXGEW 775 ++ RTDRP QQLRSL GEW Sbjct: 67 SEEARTDRPSQQLRSLNGEW 86 >SB_49150| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 79.8 bits (188), Expect = 5e-15 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 619 LAVVLHRRDWENPGVTQLNRLAAHPPFASWRNSEEA 726 LAVVL RRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 55 [lacZ-alpha fragment, 36 aa] 90 Score = 35.1 bits (77), Expect = 0.15 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +2 Query: 716 AKRPRTDRPXQQLRSLXGEW 775 ++ RTDRP QQLRSL GEW Sbjct: 87 SEEARTDRPSQQLRSLNGEW 106 >SB_49117| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 121 Score = 79.8 bits (188), Expect = 5e-15 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 619 LAVVLHRRDWENPGVTQLNRLAAHPPFASWRNSEEA 726 LAVVL RRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 40 [lacZ-alpha fragment, 36 aa] 75 Score = 35.5 bits (78), Expect = 0.11 Identities = 14/21 (66%), Positives = 17/21 (80%) Frame = +2 Query: 716 AKRPRTDRPXQQLRSLXGEWQ 778 ++ RTDRP QQLRSL GEW+ Sbjct: 72 SEEARTDRPSQQLRSLNGEWR 92 >SB_49064| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 79.8 bits (188), Expect = 5e-15 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 619 LAVVLHRRDWENPGVTQLNRLAAHPPFASWRNSEEA 726 LAVVL RRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 75 [lacZ-alpha fragment, 36 aa] 110 Score = 35.5 bits (78), Expect = 0.11 Identities = 14/21 (66%), Positives = 17/21 (80%) Frame = +2 Query: 716 AKRPRTDRPXQQLRSLXGEWQ 778 ++ RTDRP QQLRSL GEW+ Sbjct: 107 SEEARTDRPSQQLRSLNGEWR 127 >SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1) Length = 286 Score = 79.8 bits (188), Expect = 5e-15 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 619 LAVVLHRRDWENPGVTQLNRLAAHPPFASWRNSEEA 726 LAVVL RRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 195 [lacZ-alpha fragment, 36 aa] 230 Score = 35.1 bits (77), Expect = 0.15 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +2 Query: 716 AKRPRTDRPXQQLRSLXGEW 775 ++ RTDRP QQLRSL GEW Sbjct: 227 SEEARTDRPSQQLRSLNGEW 246 >SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 79.8 bits (188), Expect = 5e-15 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 619 LAVVLHRRDWENPGVTQLNRLAAHPPFASWRNSEEA 726 LAVVL RRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 53 [lacZ-alpha fragment, 36 aa] 88 Score = 35.1 bits (77), Expect = 0.15 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +2 Query: 716 AKRPRTDRPXQQLRSLXGEW 775 ++ RTDRP QQLRSL GEW Sbjct: 85 SEEARTDRPSQQLRSLNGEW 104 >SB_48522| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 79.8 bits (188), Expect = 5e-15 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 619 LAVVLHRRDWENPGVTQLNRLAAHPPFASWRNSEEA 726 LAVVL RRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 32 [lacZ-alpha fragment, 36 aa] 67 Score = 35.1 bits (77), Expect = 0.15 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +2 Query: 716 AKRPRTDRPXQQLRSLXGEW 775 ++ RTDRP QQLRSL GEW Sbjct: 64 SEEARTDRPSQQLRSLNGEW 83 >SB_48514| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 237 Score = 79.8 bits (188), Expect = 5e-15 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 619 LAVVLHRRDWENPGVTQLNRLAAHPPFASWRNSEEA 726 LAVVL RRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 86 [lacZ-alpha fragment, 36 aa] 121 Score = 35.1 bits (77), Expect = 0.15 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +2 Query: 716 AKRPRTDRPXQQLRSLXGEW 775 ++ RTDRP QQLRSL GEW Sbjct: 118 SEEARTDRPSQQLRSLNGEW 137 >SB_48486| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 79.8 bits (188), Expect = 5e-15 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 619 LAVVLHRRDWENPGVTQLNRLAAHPPFASWRNSEEA 726 LAVVL RRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 29 [lacZ-alpha fragment, 36 aa] 64 Score = 35.1 bits (77), Expect = 0.15 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +2 Query: 716 AKRPRTDRPXQQLRSLXGEW 775 ++ RTDRP QQLRSL GEW Sbjct: 61 SEEARTDRPSQQLRSLNGEW 80 >SB_48393| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 79.8 bits (188), Expect = 5e-15 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 619 LAVVLHRRDWENPGVTQLNRLAAHPPFASWRNSEEA 726 LAVVL RRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 22 [lacZ-alpha fragment, 36 aa] 57 Score = 35.5 bits (78), Expect = 0.11 Identities = 14/21 (66%), Positives = 17/21 (80%) Frame = +2 Query: 716 AKRPRTDRPXQQLRSLXGEWQ 778 ++ RTDRP QQLRSL GEW+ Sbjct: 54 SEEARTDRPSQQLRSLNGEWR 74 >SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 79.8 bits (188), Expect = 5e-15 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 619 LAVVLHRRDWENPGVTQLNRLAAHPPFASWRNSEEA 726 LAVVL RRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 49 [lacZ-alpha fragment, 36 aa] 84 Score = 35.1 bits (77), Expect = 0.15 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +2 Query: 716 AKRPRTDRPXQQLRSLXGEW 775 ++ RTDRP QQLRSL GEW Sbjct: 81 SEEARTDRPSQQLRSLNGEW 100 >SB_48129| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 79.8 bits (188), Expect = 5e-15 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 619 LAVVLHRRDWENPGVTQLNRLAAHPPFASWRNSEEA 726 LAVVL RRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 29 [lacZ-alpha fragment, 36 aa] 64 Score = 35.1 bits (77), Expect = 0.15 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +2 Query: 716 AKRPRTDRPXQQLRSLXGEW 775 ++ RTDRP QQLRSL GEW Sbjct: 61 SEEARTDRPSQQLRSLNGEW 80 >SB_48100| Best HMM Match : Transformer (HMM E-Value=5.4) Length = 325 Score = 79.8 bits (188), Expect = 5e-15 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 619 LAVVLHRRDWENPGVTQLNRLAAHPPFASWRNSEEA 726 LAVVL RRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 187 [lacZ-alpha fragment, 36 aa] 222 Score = 35.1 bits (77), Expect = 0.15 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +2 Query: 716 AKRPRTDRPXQQLRSLXGEW 775 ++ RTDRP QQLRSL GEW Sbjct: 219 SEEARTDRPSQQLRSLNGEW 238 >SB_48063| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 79.8 bits (188), Expect = 5e-15 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 619 LAVVLHRRDWENPGVTQLNRLAAHPPFASWRNSEEA 726 LAVVL RRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 29 [lacZ-alpha fragment, 36 aa] 64 Score = 35.1 bits (77), Expect = 0.15 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +2 Query: 716 AKRPRTDRPXQQLRSLXGEW 775 ++ RTDRP QQLRSL GEW Sbjct: 61 SEEARTDRPSQQLRSLNGEW 80 >SB_48045| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 79.8 bits (188), Expect = 5e-15 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 619 LAVVLHRRDWENPGVTQLNRLAAHPPFASWRNSEEA 726 LAVVL RRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 57 [lacZ-alpha fragment, 36 aa] 92 Score = 35.1 bits (77), Expect = 0.15 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +2 Query: 716 AKRPRTDRPXQQLRSLXGEW 775 ++ RTDRP QQLRSL GEW Sbjct: 89 SEEARTDRPSQQLRSLNGEW 108 >SB_48039| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 79.8 bits (188), Expect = 5e-15 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 619 LAVVLHRRDWENPGVTQLNRLAAHPPFASWRNSEEA 726 LAVVL RRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 67 [lacZ-alpha fragment, 36 aa] 102 Score = 35.1 bits (77), Expect = 0.15 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +2 Query: 716 AKRPRTDRPXQQLRSLXGEW 775 ++ RTDRP QQLRSL GEW Sbjct: 99 SEEARTDRPSQQLRSLNGEW 118 >SB_48026| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 79.8 bits (188), Expect = 5e-15 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 619 LAVVLHRRDWENPGVTQLNRLAAHPPFASWRNSEEA 726 LAVVL RRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 50 [lacZ-alpha fragment, 36 aa] 85 Score = 35.1 bits (77), Expect = 0.15 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +2 Query: 716 AKRPRTDRPXQQLRSLXGEW 775 ++ RTDRP QQLRSL GEW Sbjct: 82 SEEARTDRPSQQLRSLNGEW 101 >SB_47872| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 79.8 bits (188), Expect = 5e-15 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 619 LAVVLHRRDWENPGVTQLNRLAAHPPFASWRNSEEA 726 LAVVL RRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 57 [lacZ-alpha fragment, 36 aa] 92 Score = 35.5 bits (78), Expect = 0.11 Identities = 14/21 (66%), Positives = 17/21 (80%) Frame = +2 Query: 716 AKRPRTDRPXQQLRSLXGEWQ 778 ++ RTDRP QQLRSL GEW+ Sbjct: 89 SEEARTDRPSQQLRSLNGEWR 109 >SB_47732| Best HMM Match : Pkinase (HMM E-Value=0.0016) Length = 318 Score = 79.8 bits (188), Expect = 5e-15 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 619 LAVVLHRRDWENPGVTQLNRLAAHPPFASWRNSEEA 726 LAVVL RRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 100 [lacZ-alpha fragment, 36 aa] 135 Score = 35.5 bits (78), Expect = 0.11 Identities = 14/21 (66%), Positives = 17/21 (80%) Frame = +2 Query: 716 AKRPRTDRPXQQLRSLXGEWQ 778 ++ RTDRP QQLRSL GEW+ Sbjct: 132 SEEARTDRPSQQLRSLNGEWR 152 >SB_47536| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 79.8 bits (188), Expect = 5e-15 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 619 LAVVLHRRDWENPGVTQLNRLAAHPPFASWRNSEEA 726 LAVVL RRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 29 [lacZ-alpha fragment, 36 aa] 64 Score = 35.1 bits (77), Expect = 0.15 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +2 Query: 716 AKRPRTDRPXQQLRSLXGEW 775 ++ RTDRP QQLRSL GEW Sbjct: 61 SEEARTDRPSQQLRSLNGEW 80 >SB_47480| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 167 Score = 79.8 bits (188), Expect = 5e-15 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 619 LAVVLHRRDWENPGVTQLNRLAAHPPFASWRNSEEA 726 LAVVL RRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 76 [lacZ-alpha fragment, 36 aa] 111 Score = 35.1 bits (77), Expect = 0.15 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +2 Query: 716 AKRPRTDRPXQQLRSLXGEW 775 ++ RTDRP QQLRSL GEW Sbjct: 108 SEEARTDRPSQQLRSLNGEW 127 >SB_47399| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 79.8 bits (188), Expect = 5e-15 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 619 LAVVLHRRDWENPGVTQLNRLAAHPPFASWRNSEEA 726 LAVVL RRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 29 [lacZ-alpha fragment, 36 aa] 64 Score = 35.1 bits (77), Expect = 0.15 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +2 Query: 716 AKRPRTDRPXQQLRSLXGEW 775 ++ RTDRP QQLRSL GEW Sbjct: 61 SEEARTDRPSQQLRSLNGEW 80 >SB_47315| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 79.8 bits (188), Expect = 5e-15 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 619 LAVVLHRRDWENPGVTQLNRLAAHPPFASWRNSEEA 726 LAVVL RRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 96 [lacZ-alpha fragment, 36 aa] 131 Score = 35.1 bits (77), Expect = 0.15 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +2 Query: 716 AKRPRTDRPXQQLRSLXGEW 775 ++ RTDRP QQLRSL GEW Sbjct: 128 SEEARTDRPSQQLRSLNGEW 147 >SB_47276| Best HMM Match : DUF851 (HMM E-Value=9.6) Length = 154 Score = 79.8 bits (188), Expect = 5e-15 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 619 LAVVLHRRDWENPGVTQLNRLAAHPPFASWRNSEEA 726 LAVVL RRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 73 [lacZ-alpha fragment, 36 aa] 108 Score = 35.5 bits (78), Expect = 0.11 Identities = 14/21 (66%), Positives = 17/21 (80%) Frame = +2 Query: 716 AKRPRTDRPXQQLRSLXGEWQ 778 ++ RTDRP QQLRSL GEW+ Sbjct: 105 SEEARTDRPSQQLRSLNGEWR 125 >SB_47213| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 103 Score = 79.8 bits (188), Expect = 5e-15 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 619 LAVVLHRRDWENPGVTQLNRLAAHPPFASWRNSEEA 726 LAVVL RRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 40 [lacZ-alpha fragment, 36 aa] 75 Score = 35.1 bits (77), Expect = 0.15 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +2 Query: 716 AKRPRTDRPXQQLRSLXGEW 775 ++ RTDRP QQLRSL GEW Sbjct: 72 SEEARTDRPSQQLRSLNGEW 91 >SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 79.8 bits (188), Expect = 5e-15 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 619 LAVVLHRRDWENPGVTQLNRLAAHPPFASWRNSEEA 726 LAVVL RRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 49 [lacZ-alpha fragment, 36 aa] 84 Score = 35.1 bits (77), Expect = 0.15 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +2 Query: 716 AKRPRTDRPXQQLRSLXGEW 775 ++ RTDRP QQLRSL GEW Sbjct: 81 SEEARTDRPSQQLRSLNGEW 100 >SB_46889| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 754 Score = 79.8 bits (188), Expect = 5e-15 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 619 LAVVLHRRDWENPGVTQLNRLAAHPPFASWRNSEEA 726 LAVVL RRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 663 [lacZ-alpha fragment, 36 aa] 698 Score = 35.1 bits (77), Expect = 0.15 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +2 Query: 716 AKRPRTDRPXQQLRSLXGEW 775 ++ RTDRP QQLRSL GEW Sbjct: 695 SEEARTDRPSQQLRSLNGEW 714 >SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) Length = 139 Score = 79.8 bits (188), Expect = 5e-15 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 619 LAVVLHRRDWENPGVTQLNRLAAHPPFASWRNSEEA 726 LAVVL RRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 48 [lacZ-alpha fragment, 36 aa] 83 Score = 35.1 bits (77), Expect = 0.15 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +2 Query: 716 AKRPRTDRPXQQLRSLXGEW 775 ++ RTDRP QQLRSL GEW Sbjct: 80 SEEARTDRPSQQLRSLNGEW 99 >SB_46651| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 79.8 bits (188), Expect = 5e-15 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 619 LAVVLHRRDWENPGVTQLNRLAAHPPFASWRNSEEA 726 LAVVL RRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 37 [lacZ-alpha fragment, 36 aa] 72 Score = 35.1 bits (77), Expect = 0.15 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +2 Query: 716 AKRPRTDRPXQQLRSLXGEW 775 ++ RTDRP QQLRSL GEW Sbjct: 69 SEEARTDRPSQQLRSLNGEW 88 >SB_46649| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 79.8 bits (188), Expect = 5e-15 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 619 LAVVLHRRDWENPGVTQLNRLAAHPPFASWRNSEEA 726 LAVVL RRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 28 [lacZ-alpha fragment, 36 aa] 63 Score = 35.5 bits (78), Expect = 0.11 Identities = 14/21 (66%), Positives = 17/21 (80%) Frame = +2 Query: 716 AKRPRTDRPXQQLRSLXGEWQ 778 ++ RTDRP QQLRSL GEW+ Sbjct: 60 SEEARTDRPSQQLRSLNGEWR 80 >SB_46589| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 562 Score = 79.8 bits (188), Expect = 5e-15 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 619 LAVVLHRRDWENPGVTQLNRLAAHPPFASWRNSEEA 726 LAVVL RRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 146 [lacZ-alpha fragment, 36 aa] 181 Score = 35.5 bits (78), Expect = 0.11 Identities = 14/21 (66%), Positives = 17/21 (80%) Frame = +2 Query: 716 AKRPRTDRPXQQLRSLXGEWQ 778 ++ RTDRP QQLRSL GEW+ Sbjct: 178 SEEARTDRPSQQLRSLNGEWR 198 >SB_46529| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 79.8 bits (188), Expect = 5e-15 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 619 LAVVLHRRDWENPGVTQLNRLAAHPPFASWRNSEEA 726 LAVVL RRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 38 [lacZ-alpha fragment, 36 aa] 73 Score = 35.1 bits (77), Expect = 0.15 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +2 Query: 716 AKRPRTDRPXQQLRSLXGEW 775 ++ RTDRP QQLRSL GEW Sbjct: 70 SEEARTDRPSQQLRSLNGEW 89 >SB_46517| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 79.8 bits (188), Expect = 5e-15 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 619 LAVVLHRRDWENPGVTQLNRLAAHPPFASWRNSEEA 726 LAVVL RRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 29 [lacZ-alpha fragment, 36 aa] 64 Score = 35.1 bits (77), Expect = 0.15 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +2 Query: 716 AKRPRTDRPXQQLRSLXGEW 775 ++ RTDRP QQLRSL GEW Sbjct: 61 SEEARTDRPSQQLRSLNGEW 80 >SB_46424| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 79.8 bits (188), Expect = 5e-15 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 619 LAVVLHRRDWENPGVTQLNRLAAHPPFASWRNSEEA 726 LAVVL RRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 29 [lacZ-alpha fragment, 36 aa] 64 Score = 35.1 bits (77), Expect = 0.15 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +2 Query: 716 AKRPRTDRPXQQLRSLXGEW 775 ++ RTDRP QQLRSL GEW Sbjct: 61 SEEARTDRPSQQLRSLNGEW 80 >SB_46412| Best HMM Match : HEAT (HMM E-Value=8) Length = 140 Score = 79.8 bits (188), Expect = 5e-15 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 619 LAVVLHRRDWENPGVTQLNRLAAHPPFASWRNSEEA 726 LAVVL RRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 59 [lacZ-alpha fragment, 36 aa] 94 Score = 35.5 bits (78), Expect = 0.11 Identities = 14/21 (66%), Positives = 17/21 (80%) Frame = +2 Query: 716 AKRPRTDRPXQQLRSLXGEWQ 778 ++ RTDRP QQLRSL GEW+ Sbjct: 91 SEEARTDRPSQQLRSLNGEWR 111 >SB_46374| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 79.8 bits (188), Expect = 5e-15 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 619 LAVVLHRRDWENPGVTQLNRLAAHPPFASWRNSEEA 726 LAVVL RRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 88 [lacZ-alpha fragment, 36 aa] 123 Score = 35.5 bits (78), Expect = 0.11 Identities = 14/21 (66%), Positives = 17/21 (80%) Frame = +2 Query: 716 AKRPRTDRPXQQLRSLXGEWQ 778 ++ RTDRP QQLRSL GEW+ Sbjct: 120 SEEARTDRPSQQLRSLNGEWR 140 >SB_46361| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 79.8 bits (188), Expect = 5e-15 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 619 LAVVLHRRDWENPGVTQLNRLAAHPPFASWRNSEEA 726 LAVVL RRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 36 [lacZ-alpha fragment, 36 aa] 71 Score = 35.1 bits (77), Expect = 0.15 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +2 Query: 716 AKRPRTDRPXQQLRSLXGEW 775 ++ RTDRP QQLRSL GEW Sbjct: 68 SEEARTDRPSQQLRSLNGEW 87 >SB_46344| Best HMM Match : ig (HMM E-Value=0.0082) Length = 181 Score = 79.8 bits (188), Expect = 5e-15 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 619 LAVVLHRRDWENPGVTQLNRLAAHPPFASWRNSEEA 726 LAVVL RRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 100 [lacZ-alpha fragment, 36 aa] 135 Score = 35.5 bits (78), Expect = 0.11 Identities = 14/21 (66%), Positives = 17/21 (80%) Frame = +2 Query: 716 AKRPRTDRPXQQLRSLXGEWQ 778 ++ RTDRP QQLRSL GEW+ Sbjct: 132 SEEARTDRPSQQLRSLNGEWR 152 >SB_46321| Best HMM Match : DUF765 (HMM E-Value=3.4) Length = 134 Score = 79.8 bits (188), Expect = 5e-15 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 619 LAVVLHRRDWENPGVTQLNRLAAHPPFASWRNSEEA 726 LAVVL RRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 43 [lacZ-alpha fragment, 36 aa] 78 Score = 35.1 bits (77), Expect = 0.15 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +2 Query: 716 AKRPRTDRPXQQLRSLXGEW 775 ++ RTDRP QQLRSL GEW Sbjct: 75 SEEARTDRPSQQLRSLNGEW 94 >SB_46308| Best HMM Match : IMS (HMM E-Value=0) Length = 1245 Score = 79.8 bits (188), Expect = 5e-15 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 619 LAVVLHRRDWENPGVTQLNRLAAHPPFASWRNSEEA 726 LAVVL RRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 1190 [lacZ-alpha fragment, 36 aa] 1225 Score = 45.2 bits (102), Expect = 1e-04 Identities = 21/26 (80%), Positives = 22/26 (84%) Frame = -2 Query: 743 KGDRCGASSLLRQLAKGGCAARRLSW 666 +G ASSLLRQLAKGGCAARRLSW Sbjct: 414 EGRSVRASSLLRQLAKGGCAARRLSW 439 Score = 38.7 bits (86), Expect = 0.012 Identities = 16/37 (43%), Positives = 20/37 (54%) Frame = -1 Query: 774 HSPXRLRNCWXGRSVRGLFAITPAGERGMCCKAIKLG 664 HSP RLRNCW GRSVR + + G + + G Sbjct: 404 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWG 440 Score = 35.5 bits (78), Expect = 0.11 Identities = 14/21 (66%), Positives = 17/21 (80%) Frame = +2 Query: 716 AKRPRTDRPXQQLRSLXGEWQ 778 ++ RTDRP QQLRSL GEW+ Sbjct: 1222 SEEARTDRPSQQLRSLNGEWR 1242 >SB_46303| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 79.8 bits (188), Expect = 5e-15 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 619 LAVVLHRRDWENPGVTQLNRLAAHPPFASWRNSEEA 726 LAVVL RRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 42 [lacZ-alpha fragment, 36 aa] 77 Score = 35.1 bits (77), Expect = 0.15 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = +2 Query: 716 AKRPRTDRPXQQLRSLXGEW 775 ++ RTDRP QQLRSL GEW Sbjct: 74 SEEARTDRPSQQLRSLNGEW 93 >SB_46194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 79.8 bits (188), Expect = 5e-15 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 619 LAVVLHRRDWENPGVTQLNRLAAHPPFASWRNSEEA 726 LAVVL RRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 32 [lacZ-alpha fragment, 36 aa] 67 Score = 35.5 bits (78), Expect = 0.11 Identities = 14/21 (66%), Positives = 17/21 (80%) Frame = +2 Query: 716 AKRPRTDRPXQQLRSLXGEWQ 778 ++ RTDRP QQLRSL GEW+ Sbjct: 64 SEEARTDRPSQQLRSLNGEWR 84 >SB_45914| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 206 Score = 79.8 bits (188), Expect = 5e-15 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = +1 Query: 619 LAVVLHRRDWENPGVTQLNRLAAHPPFASWRNSEEA 726 LAVVL RRDWENPGVTQLNRLAAHPPFASWRNSEEA Sbjct: 125 [lacZ-alpha fragment, 36 aa] 160 Score = 35.5 bits (78), Expect = 0.11 Identities = 14/21 (66%), Positives = 17/21 (80%) Frame = +2 Query: 716 AKRPRTDRPXQQLRSLXGEWQ 778 ++ RTDRP QQLRSL GEW+ Sbjct: 157 SEEARTDRPSQQLRSLNGEWR 177 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 34,787,335 Number of Sequences: 59808 Number of extensions: 614552 Number of successful extensions: 9202 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 4976 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9118 length of database: 16,821,457 effective HSP length: 85 effective length of database: 11,737,777 effective search space used: 4953341894 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -