BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030731E7_B01_e578_03.seq (1436 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_34678| Best HMM Match : Bromodomain (HMM E-Value=9e-25) 111 1e-24 SB_40566| Best HMM Match : No HMM Matches (HMM E-Value=.) 110 3e-24 SB_55030| Best HMM Match : Toxin_27 (HMM E-Value=1.2) 110 3e-24 SB_56660| Best HMM Match : zf-C2H2 (HMM E-Value=0) 109 4e-24 SB_8714| Best HMM Match : No HMM Matches (HMM E-Value=.) 109 4e-24 SB_6875| Best HMM Match : No HMM Matches (HMM E-Value=.) 109 5e-24 SB_55579| Best HMM Match : Rhodanese (HMM E-Value=9.2e-29) 109 7e-24 SB_17049| Best HMM Match : No HMM Matches (HMM E-Value=.) 109 7e-24 SB_7402| Best HMM Match : Extensin_2 (HMM E-Value=2) 109 7e-24 SB_6842| Best HMM Match : No HMM Matches (HMM E-Value=.) 108 9e-24 SB_41244| Best HMM Match : No HMM Matches (HMM E-Value=.) 108 9e-24 SB_47732| Best HMM Match : Pkinase (HMM E-Value=0.0016) 108 1e-23 SB_8582| Best HMM Match : CsgG (HMM E-Value=4.9e-06) 108 1e-23 SB_40229| Best HMM Match : No HMM Matches (HMM E-Value=.) 108 1e-23 SB_46589| Best HMM Match : No HMM Matches (HMM E-Value=.) 107 2e-23 SB_46308| Best HMM Match : IMS (HMM E-Value=0) 107 2e-23 SB_44358| Best HMM Match : No HMM Matches (HMM E-Value=.) 107 2e-23 SB_33270| Best HMM Match : No HMM Matches (HMM E-Value=.) 107 2e-23 SB_22440| Best HMM Match : No HMM Matches (HMM E-Value=.) 107 2e-23 SB_20378| Best HMM Match : Adeno_E1B_19K (HMM E-Value=5.7) 107 2e-23 SB_59624| Best HMM Match : No HMM Matches (HMM E-Value=.) 107 2e-23 SB_58792| Best HMM Match : No HMM Matches (HMM E-Value=.) 107 2e-23 SB_58723| Best HMM Match : No HMM Matches (HMM E-Value=.) 107 2e-23 SB_58076| Best HMM Match : No HMM Matches (HMM E-Value=.) 107 2e-23 SB_57885| Best HMM Match : No HMM Matches (HMM E-Value=.) 107 2e-23 SB_55921| Best HMM Match : Aldo_ket_red (HMM E-Value=0.16) 107 2e-23 SB_55719| Best HMM Match : No HMM Matches (HMM E-Value=.) 107 2e-23 SB_55288| Best HMM Match : TLD (HMM E-Value=0.00092) 107 2e-23 SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.) 107 2e-23 SB_52130| Best HMM Match : No HMM Matches (HMM E-Value=.) 107 2e-23 SB_52085| Best HMM Match : TIL (HMM E-Value=2.5) 107 2e-23 SB_51638| Best HMM Match : No HMM Matches (HMM E-Value=.) 107 2e-23 SB_50850| Best HMM Match : No HMM Matches (HMM E-Value=.) 107 2e-23 SB_49644| Best HMM Match : No HMM Matches (HMM E-Value=.) 107 2e-23 SB_49495| Best HMM Match : No HMM Matches (HMM E-Value=.) 107 2e-23 SB_49117| Best HMM Match : No HMM Matches (HMM E-Value=.) 107 2e-23 SB_49064| Best HMM Match : No HMM Matches (HMM E-Value=.) 107 2e-23 SB_48393| Best HMM Match : No HMM Matches (HMM E-Value=.) 107 2e-23 SB_47872| Best HMM Match : No HMM Matches (HMM E-Value=.) 107 2e-23 SB_47291| Best HMM Match : PilN (HMM E-Value=0.75) 107 2e-23 SB_47276| Best HMM Match : DUF851 (HMM E-Value=9.6) 107 2e-23 SB_46649| Best HMM Match : No HMM Matches (HMM E-Value=.) 107 2e-23 SB_46412| Best HMM Match : HEAT (HMM E-Value=8) 107 2e-23 SB_46374| Best HMM Match : No HMM Matches (HMM E-Value=.) 107 2e-23 SB_46344| Best HMM Match : ig (HMM E-Value=0.0082) 107 2e-23 SB_46194| Best HMM Match : No HMM Matches (HMM E-Value=.) 107 2e-23 SB_45914| Best HMM Match : No HMM Matches (HMM E-Value=.) 107 2e-23 SB_43671| Best HMM Match : No HMM Matches (HMM E-Value=.) 107 2e-23 SB_43630| Best HMM Match : No HMM Matches (HMM E-Value=.) 107 2e-23 SB_43145| Best HMM Match : PEGSRP (HMM E-Value=7.2) 107 2e-23 SB_42949| Best HMM Match : SRCR (HMM E-Value=1.6e-14) 107 2e-23 SB_42831| Best HMM Match : No HMM Matches (HMM E-Value=.) 107 2e-23 SB_42655| Best HMM Match : No HMM Matches (HMM E-Value=.) 107 2e-23 SB_42158| Best HMM Match : No HMM Matches (HMM E-Value=.) 107 2e-23 SB_42069| Best HMM Match : No HMM Matches (HMM E-Value=.) 107 2e-23 SB_41728| Best HMM Match : No HMM Matches (HMM E-Value=.) 107 2e-23 SB_41712| Best HMM Match : No HMM Matches (HMM E-Value=.) 107 2e-23 SB_41481| Best HMM Match : No HMM Matches (HMM E-Value=.) 107 2e-23 SB_40939| Best HMM Match : No HMM Matches (HMM E-Value=.) 107 2e-23 SB_40610| Best HMM Match : No HMM Matches (HMM E-Value=.) 107 2e-23 SB_40462| Best HMM Match : No HMM Matches (HMM E-Value=.) 107 2e-23 SB_38016| Best HMM Match : No HMM Matches (HMM E-Value=.) 107 2e-23 SB_37690| Best HMM Match : IgG_binding_B (HMM E-Value=4.2) 107 2e-23 SB_37661| Best HMM Match : No HMM Matches (HMM E-Value=.) 107 2e-23 SB_37536| Best HMM Match : No HMM Matches (HMM E-Value=.) 107 2e-23 SB_37245| Best HMM Match : Disintegrin (HMM E-Value=7.9) 107 2e-23 SB_36865| Best HMM Match : No HMM Matches (HMM E-Value=.) 107 2e-23 SB_35997| Best HMM Match : Phage_fiber (HMM E-Value=0.78) 107 2e-23 SB_35689| Best HMM Match : No HMM Matches (HMM E-Value=.) 107 2e-23 SB_35257| Best HMM Match : Sec8_exocyst (HMM E-Value=0.59) 107 2e-23 SB_34829| Best HMM Match : No HMM Matches (HMM E-Value=.) 107 2e-23 SB_34793| Best HMM Match : TIL (HMM E-Value=4.5) 107 2e-23 SB_34015| Best HMM Match : No HMM Matches (HMM E-Value=.) 107 2e-23 SB_32411| Best HMM Match : No HMM Matches (HMM E-Value=.) 107 2e-23 SB_32110| Best HMM Match : PEGSRP (HMM E-Value=9.6) 107 2e-23 SB_31658| Best HMM Match : Arm (HMM E-Value=0.91) 107 2e-23 SB_31511| Best HMM Match : No HMM Matches (HMM E-Value=.) 107 2e-23 SB_31227| Best HMM Match : RIO1 (HMM E-Value=0.13) 107 2e-23 SB_31056| Best HMM Match : Virus_P-coat (HMM E-Value=6.4) 107 2e-23 SB_30810| Best HMM Match : JmjC (HMM E-Value=0.0021) 107 2e-23 SB_30192| Best HMM Match : No HMM Matches (HMM E-Value=.) 107 2e-23 SB_28922| Best HMM Match : No HMM Matches (HMM E-Value=.) 107 2e-23 SB_28866| Best HMM Match : PhdYeFM (HMM E-Value=8.3) 107 2e-23 SB_28269| Best HMM Match : No HMM Matches (HMM E-Value=.) 107 2e-23 SB_27927| Best HMM Match : No HMM Matches (HMM E-Value=.) 107 2e-23 SB_27779| Best HMM Match : No HMM Matches (HMM E-Value=.) 107 2e-23 SB_27047| Best HMM Match : No HMM Matches (HMM E-Value=.) 107 2e-23 SB_26995| Best HMM Match : No HMM Matches (HMM E-Value=.) 107 2e-23 SB_25936| Best HMM Match : No HMM Matches (HMM E-Value=.) 107 2e-23 SB_24859| Best HMM Match : HAP (HMM E-Value=6.4) 107 2e-23 SB_24787| Best HMM Match : No HMM Matches (HMM E-Value=.) 107 2e-23 SB_24544| Best HMM Match : PSCyt1 (HMM E-Value=4.3) 107 2e-23 SB_23437| Best HMM Match : No HMM Matches (HMM E-Value=.) 107 2e-23 SB_22254| Best HMM Match : No HMM Matches (HMM E-Value=.) 107 2e-23 SB_21247| Best HMM Match : No HMM Matches (HMM E-Value=.) 107 2e-23 SB_20900| Best HMM Match : No HMM Matches (HMM E-Value=.) 107 2e-23 SB_20864| Best HMM Match : No HMM Matches (HMM E-Value=.) 107 2e-23 SB_20814| Best HMM Match : No HMM Matches (HMM E-Value=.) 107 2e-23 SB_19461| Best HMM Match : No HMM Matches (HMM E-Value=.) 107 2e-23 SB_18812| Best HMM Match : No HMM Matches (HMM E-Value=.) 107 2e-23 SB_18289| Best HMM Match : IgG_binding_B (HMM E-Value=7) 107 2e-23 SB_17565| Best HMM Match : EGF (HMM E-Value=5.1e-05) 107 2e-23 SB_16725| Best HMM Match : DAGAT (HMM E-Value=1e-39) 107 2e-23 SB_16155| Best HMM Match : No HMM Matches (HMM E-Value=.) 107 2e-23 SB_15873| Best HMM Match : No HMM Matches (HMM E-Value=.) 107 2e-23 SB_15493| Best HMM Match : No HMM Matches (HMM E-Value=.) 107 2e-23 SB_15346| Best HMM Match : No HMM Matches (HMM E-Value=.) 107 2e-23 SB_15295| Best HMM Match : No HMM Matches (HMM E-Value=.) 107 2e-23 SB_14936| Best HMM Match : Pep_M12B_propep (HMM E-Value=9.7) 107 2e-23 SB_14045| Best HMM Match : No HMM Matches (HMM E-Value=.) 107 2e-23 SB_13480| Best HMM Match : No HMM Matches (HMM E-Value=.) 107 2e-23 SB_13236| Best HMM Match : No HMM Matches (HMM E-Value=.) 107 2e-23 SB_12962| Best HMM Match : No HMM Matches (HMM E-Value=.) 107 2e-23 SB_12873| Best HMM Match : No HMM Matches (HMM E-Value=.) 107 2e-23 SB_12187| Best HMM Match : No HMM Matches (HMM E-Value=.) 107 2e-23 SB_12019| Best HMM Match : No HMM Matches (HMM E-Value=.) 107 2e-23 SB_11632| Best HMM Match : No HMM Matches (HMM E-Value=.) 107 2e-23 SB_10031| Best HMM Match : No HMM Matches (HMM E-Value=.) 107 2e-23 SB_9995| Best HMM Match : No HMM Matches (HMM E-Value=.) 107 2e-23 SB_9450| Best HMM Match : CM_1 (HMM E-Value=3.1) 107 2e-23 SB_8806| Best HMM Match : No HMM Matches (HMM E-Value=.) 107 2e-23 SB_8621| Best HMM Match : No HMM Matches (HMM E-Value=.) 107 2e-23 SB_8530| Best HMM Match : ThiC (HMM E-Value=2.7e-07) 107 2e-23 SB_8498| Best HMM Match : No HMM Matches (HMM E-Value=.) 107 2e-23 SB_5521| Best HMM Match : SWIM (HMM E-Value=6.9) 107 2e-23 SB_5457| Best HMM Match : No HMM Matches (HMM E-Value=.) 107 2e-23 SB_3676| Best HMM Match : Cuticle_2 (HMM E-Value=3.2) 107 2e-23 SB_2468| Best HMM Match : No HMM Matches (HMM E-Value=.) 107 2e-23 SB_2230| Best HMM Match : No HMM Matches (HMM E-Value=.) 107 2e-23 SB_965| Best HMM Match : IgG_binding_B (HMM E-Value=8.5) 107 2e-23 SB_56058| Best HMM Match : Phasin (HMM E-Value=2.7) 107 2e-23 SB_55925| Best HMM Match : Homeobox (HMM E-Value=1e-26) 107 2e-23 SB_55779| Best HMM Match : No HMM Matches (HMM E-Value=.) 107 2e-23 SB_55121| Best HMM Match : DUF971 (HMM E-Value=8.5) 107 2e-23 SB_54995| Best HMM Match : No HMM Matches (HMM E-Value=.) 107 2e-23 SB_53532| Best HMM Match : IgG_binding_B (HMM E-Value=7.8) 107 2e-23 SB_52523| Best HMM Match : No HMM Matches (HMM E-Value=.) 107 2e-23 SB_52081| Best HMM Match : DUF1634 (HMM E-Value=0.55) 107 2e-23 SB_51949| Best HMM Match : Toxin_14 (HMM E-Value=0.051) 107 2e-23 SB_49112| Best HMM Match : No HMM Matches (HMM E-Value=.) 107 2e-23 SB_48731| Best HMM Match : zf-C3HC4 (HMM E-Value=6.5e-08) 107 2e-23 SB_48358| Best HMM Match : No HMM Matches (HMM E-Value=.) 107 2e-23 SB_46830| Best HMM Match : Succ_DH_flav_C (HMM E-Value=3.2e-37) 107 2e-23 SB_46185| Best HMM Match : Flt3_lig (HMM E-Value=3.3) 107 2e-23 SB_45065| Best HMM Match : No HMM Matches (HMM E-Value=.) 107 2e-23 SB_44400| Best HMM Match : AT_hook (HMM E-Value=3.3) 107 2e-23 SB_43660| Best HMM Match : No HMM Matches (HMM E-Value=.) 107 2e-23 SB_43339| Best HMM Match : SAC3_GANP (HMM E-Value=1.8e-09) 107 2e-23 SB_42664| Best HMM Match : No HMM Matches (HMM E-Value=.) 107 2e-23 SB_42128| Best HMM Match : No HMM Matches (HMM E-Value=.) 107 2e-23 SB_41564| Best HMM Match : No HMM Matches (HMM E-Value=.) 107 2e-23 SB_40139| Best HMM Match : No HMM Matches (HMM E-Value=.) 107 2e-23 SB_36598| Best HMM Match : E-MAP-115 (HMM E-Value=0.092) 107 2e-23 SB_35835| Best HMM Match : No HMM Matches (HMM E-Value=.) 107 2e-23 SB_31775| Best HMM Match : No HMM Matches (HMM E-Value=.) 107 2e-23 SB_31293| Best HMM Match : No HMM Matches (HMM E-Value=.) 107 2e-23 SB_30891| Best HMM Match : LIM (HMM E-Value=4.40008e-43) 107 2e-23 SB_30664| Best HMM Match : No HMM Matches (HMM E-Value=.) 107 2e-23 SB_28552| Best HMM Match : No HMM Matches (HMM E-Value=.) 107 2e-23 SB_27244| Best HMM Match : No HMM Matches (HMM E-Value=.) 107 2e-23 SB_26386| Best HMM Match : No HMM Matches (HMM E-Value=.) 107 2e-23 SB_25785| Best HMM Match : No HMM Matches (HMM E-Value=.) 107 2e-23 SB_25673| Best HMM Match : MFS_1 (HMM E-Value=0.18) 107 2e-23 SB_20758| Best HMM Match : No HMM Matches (HMM E-Value=.) 107 2e-23 SB_20620| Best HMM Match : zf-HIT (HMM E-Value=8.5e-10) 107 2e-23 SB_19831| Best HMM Match : No HMM Matches (HMM E-Value=.) 107 2e-23 SB_19310| Best HMM Match : No HMM Matches (HMM E-Value=.) 107 2e-23 SB_14754| Best HMM Match : No HMM Matches (HMM E-Value=.) 107 2e-23 SB_12047| Best HMM Match : No HMM Matches (HMM E-Value=.) 107 2e-23 SB_11928| Best HMM Match : No HMM Matches (HMM E-Value=.) 107 2e-23 SB_11382| Best HMM Match : No HMM Matches (HMM E-Value=.) 107 2e-23 SB_9250| Best HMM Match : BAG (HMM E-Value=6.2) 107 2e-23 SB_8032| Best HMM Match : IBB (HMM E-Value=0.46) 107 2e-23 SB_7769| Best HMM Match : Histone (HMM E-Value=0.2) 107 2e-23 SB_7742| Best HMM Match : HEAT (HMM E-Value=9e-23) 107 2e-23 SB_5394| Best HMM Match : PEGSRP (HMM E-Value=1.5) 107 2e-23 SB_372| Best HMM Match : CBM_2 (HMM E-Value=0.00043) 107 2e-23 SB_29521| Best HMM Match : No HMM Matches (HMM E-Value=.) 106 4e-23 SB_6070| Best HMM Match : PEGSRP (HMM E-Value=3.8) 106 4e-23 SB_43138| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.3e-14) 106 5e-23 SB_8442| Best HMM Match : No HMM Matches (HMM E-Value=.) 106 5e-23 SB_57829| Best HMM Match : No HMM Matches (HMM E-Value=.) 105 7e-23 SB_57692| Best HMM Match : No HMM Matches (HMM E-Value=.) 105 7e-23 SB_57259| Best HMM Match : No HMM Matches (HMM E-Value=.) 105 7e-23 SB_56880| Best HMM Match : No HMM Matches (HMM E-Value=.) 105 7e-23 SB_56642| Best HMM Match : No HMM Matches (HMM E-Value=.) 105 7e-23 SB_55703| Best HMM Match : No HMM Matches (HMM E-Value=.) 105 7e-23 SB_55192| Best HMM Match : No HMM Matches (HMM E-Value=.) 105 7e-23 SB_53366| Best HMM Match : No HMM Matches (HMM E-Value=.) 105 7e-23 SB_52265| Best HMM Match : No HMM Matches (HMM E-Value=.) 105 7e-23 SB_51529| Best HMM Match : No HMM Matches (HMM E-Value=.) 105 7e-23 SB_50473| Best HMM Match : No HMM Matches (HMM E-Value=.) 105 7e-23 SB_49542| Best HMM Match : No HMM Matches (HMM E-Value=.) 105 7e-23 SB_45642| Best HMM Match : No HMM Matches (HMM E-Value=.) 105 7e-23 SB_45291| Best HMM Match : No HMM Matches (HMM E-Value=.) 105 7e-23 SB_44894| Best HMM Match : No HMM Matches (HMM E-Value=.) 105 7e-23 SB_44606| Best HMM Match : No HMM Matches (HMM E-Value=.) 105 7e-23 SB_44604| Best HMM Match : No HMM Matches (HMM E-Value=.) 105 7e-23 SB_43569| Best HMM Match : No HMM Matches (HMM E-Value=.) 105 7e-23 SB_42725| Best HMM Match : No HMM Matches (HMM E-Value=.) 105 7e-23 SB_41806| Best HMM Match : No HMM Matches (HMM E-Value=.) 105 7e-23 SB_39373| Best HMM Match : No HMM Matches (HMM E-Value=.) 105 7e-23 SB_38916| Best HMM Match : No HMM Matches (HMM E-Value=.) 105 7e-23 SB_37412| Best HMM Match : No HMM Matches (HMM E-Value=.) 105 7e-23 SB_34683| Best HMM Match : No HMM Matches (HMM E-Value=.) 105 7e-23 SB_34501| Best HMM Match : No HMM Matches (HMM E-Value=.) 105 7e-23 SB_33403| Best HMM Match : No HMM Matches (HMM E-Value=.) 105 7e-23 SB_32674| Best HMM Match : No HMM Matches (HMM E-Value=.) 105 7e-23 SB_32508| Best HMM Match : No HMM Matches (HMM E-Value=.) 105 7e-23 SB_30786| Best HMM Match : No HMM Matches (HMM E-Value=.) 105 7e-23 SB_29084| Best HMM Match : No HMM Matches (HMM E-Value=.) 105 7e-23 SB_27619| Best HMM Match : No HMM Matches (HMM E-Value=.) 105 7e-23 SB_24181| Best HMM Match : No HMM Matches (HMM E-Value=.) 105 7e-23 SB_22658| Best HMM Match : Protamine_3 (HMM E-Value=9.6) 105 7e-23 SB_22468| Best HMM Match : CUT (HMM E-Value=6.8) 105 7e-23 SB_20839| Best HMM Match : No HMM Matches (HMM E-Value=.) 105 7e-23 SB_20747| Best HMM Match : No HMM Matches (HMM E-Value=.) 105 7e-23 SB_15150| Best HMM Match : No HMM Matches (HMM E-Value=.) 105 7e-23 SB_15134| Best HMM Match : No HMM Matches (HMM E-Value=.) 105 7e-23 SB_15127| Best HMM Match : No HMM Matches (HMM E-Value=.) 105 7e-23 SB_14862| Best HMM Match : No HMM Matches (HMM E-Value=.) 105 7e-23 SB_13372| Best HMM Match : No HMM Matches (HMM E-Value=.) 105 7e-23 SB_12726| Best HMM Match : No HMM Matches (HMM E-Value=.) 105 7e-23 SB_12236| Best HMM Match : No HMM Matches (HMM E-Value=.) 105 7e-23 SB_11249| Best HMM Match : No HMM Matches (HMM E-Value=.) 105 7e-23 SB_10911| Best HMM Match : No HMM Matches (HMM E-Value=.) 105 7e-23 SB_10687| Best HMM Match : No HMM Matches (HMM E-Value=.) 105 7e-23 SB_10456| Best HMM Match : No HMM Matches (HMM E-Value=.) 105 7e-23 SB_9697| Best HMM Match : No HMM Matches (HMM E-Value=.) 105 7e-23 SB_7973| Best HMM Match : No HMM Matches (HMM E-Value=.) 105 7e-23 SB_7142| Best HMM Match : No HMM Matches (HMM E-Value=.) 105 7e-23 SB_6464| Best HMM Match : No HMM Matches (HMM E-Value=.) 105 7e-23 SB_6117| Best HMM Match : No HMM Matches (HMM E-Value=.) 105 7e-23 SB_4705| Best HMM Match : No HMM Matches (HMM E-Value=.) 105 7e-23 SB_4191| Best HMM Match : No HMM Matches (HMM E-Value=.) 105 7e-23 SB_3728| Best HMM Match : No HMM Matches (HMM E-Value=.) 105 7e-23 SB_1204| Best HMM Match : No HMM Matches (HMM E-Value=.) 105 7e-23 SB_58797| Best HMM Match : No HMM Matches (HMM E-Value=.) 105 7e-23 SB_54425| Best HMM Match : No HMM Matches (HMM E-Value=.) 105 7e-23 SB_51954| Best HMM Match : No HMM Matches (HMM E-Value=.) 105 7e-23 SB_51253| Best HMM Match : No HMM Matches (HMM E-Value=.) 105 7e-23 SB_45537| Best HMM Match : No HMM Matches (HMM E-Value=.) 105 7e-23 SB_42518| Best HMM Match : No HMM Matches (HMM E-Value=.) 105 7e-23 SB_39279| Best HMM Match : No HMM Matches (HMM E-Value=.) 105 7e-23 SB_36908| Best HMM Match : No HMM Matches (HMM E-Value=.) 105 7e-23 SB_34602| Best HMM Match : No HMM Matches (HMM E-Value=.) 105 7e-23 SB_32133| Best HMM Match : No HMM Matches (HMM E-Value=.) 105 7e-23 SB_31269| Best HMM Match : No HMM Matches (HMM E-Value=.) 105 7e-23 SB_27230| Best HMM Match : No HMM Matches (HMM E-Value=.) 105 7e-23 SB_19077| Best HMM Match : No HMM Matches (HMM E-Value=.) 105 7e-23 SB_15849| Best HMM Match : No HMM Matches (HMM E-Value=.) 105 7e-23 SB_12231| Best HMM Match : No HMM Matches (HMM E-Value=.) 105 7e-23 SB_11962| Best HMM Match : No HMM Matches (HMM E-Value=.) 105 7e-23 SB_11225| Best HMM Match : No HMM Matches (HMM E-Value=.) 105 7e-23 SB_9128| Best HMM Match : No HMM Matches (HMM E-Value=.) 105 7e-23 SB_2918| Best HMM Match : No HMM Matches (HMM E-Value=.) 105 7e-23 SB_1078| Best HMM Match : No HMM Matches (HMM E-Value=.) 105 7e-23 SB_51515| Best HMM Match : No HMM Matches (HMM E-Value=.) 105 1e-22 SB_25848| Best HMM Match : No HMM Matches (HMM E-Value=.) 105 1e-22 SB_59802| Best HMM Match : No HMM Matches (HMM E-Value=.) 104 2e-22 SB_58967| Best HMM Match : Sec23_BS (HMM E-Value=5.9) 104 2e-22 SB_54503| Best HMM Match : DUF753 (HMM E-Value=4.7) 104 2e-22 SB_53077| Best HMM Match : SRP54_N (HMM E-Value=1.8) 104 2e-22 SB_51967| Best HMM Match : Wzy_C (HMM E-Value=7.3) 104 2e-22 SB_50928| Best HMM Match : 7tm_2 (HMM E-Value=4.7e-07) 104 2e-22 SB_48422| Best HMM Match : No HMM Matches (HMM E-Value=.) 104 2e-22 SB_41068| Best HMM Match : No HMM Matches (HMM E-Value=.) 104 2e-22 SB_40980| Best HMM Match : ANF_receptor (HMM E-Value=0.00014) 104 2e-22 SB_38774| Best HMM Match : No HMM Matches (HMM E-Value=.) 104 2e-22 SB_38425| Best HMM Match : No HMM Matches (HMM E-Value=.) 104 2e-22 SB_36014| Best HMM Match : DUF437 (HMM E-Value=6.4) 104 2e-22 SB_35151| Best HMM Match : DUF589 (HMM E-Value=7.5) 104 2e-22 SB_34685| Best HMM Match : RNA_pol_A_bac (HMM E-Value=1.8) 104 2e-22 SB_31889| Best HMM Match : No HMM Matches (HMM E-Value=.) 104 2e-22 SB_21523| Best HMM Match : Pkinase (HMM E-Value=9.5e-14) 104 2e-22 SB_20847| Best HMM Match : No HMM Matches (HMM E-Value=.) 104 2e-22 SB_18538| Best HMM Match : No HMM Matches (HMM E-Value=.) 104 2e-22 SB_18436| Best HMM Match : No HMM Matches (HMM E-Value=.) 104 2e-22 SB_18411| Best HMM Match : No HMM Matches (HMM E-Value=.) 104 2e-22 SB_18158| Best HMM Match : No HMM Matches (HMM E-Value=.) 104 2e-22 SB_15818| Best HMM Match : Apo-VLDL-II (HMM E-Value=1.2) 104 2e-22 SB_7849| Best HMM Match : No HMM Matches (HMM E-Value=.) 104 2e-22 SB_7261| Best HMM Match : RHS (HMM E-Value=5.3) 104 2e-22 SB_3671| Best HMM Match : No HMM Matches (HMM E-Value=.) 104 2e-22 SB_2384| Best HMM Match : No HMM Matches (HMM E-Value=.) 104 2e-22 SB_751| Best HMM Match : rve (HMM E-Value=7.5e-12) 104 2e-22 SB_58440| Best HMM Match : Ribosomal_L9_C (HMM E-Value=0.81) 104 2e-22 SB_56970| Best HMM Match : Thaumatin (HMM E-Value=5.4) 104 2e-22 SB_56955| Best HMM Match : No HMM Matches (HMM E-Value=.) 104 2e-22 SB_55954| Best HMM Match : TIL (HMM E-Value=0.74) 104 2e-22 SB_54421| Best HMM Match : HipA_C (HMM E-Value=7.5) 104 2e-22 SB_53662| Best HMM Match : Protamine_P2 (HMM E-Value=9.2) 104 2e-22 SB_53044| Best HMM Match : TcpA (HMM E-Value=3.1) 104 2e-22 SB_50818| Best HMM Match : No HMM Matches (HMM E-Value=.) 104 2e-22 SB_50222| Best HMM Match : No HMM Matches (HMM E-Value=.) 104 2e-22 SB_49899| Best HMM Match : No HMM Matches (HMM E-Value=.) 104 2e-22 SB_49895| Best HMM Match : NACHT (HMM E-Value=7.7) 104 2e-22 SB_49629| Best HMM Match : No HMM Matches (HMM E-Value=.) 104 2e-22 SB_46484| Best HMM Match : No HMM Matches (HMM E-Value=.) 104 2e-22 SB_43722| Best HMM Match : TPR_4 (HMM E-Value=0.69) 104 2e-22 SB_42300| Best HMM Match : Filament_head (HMM E-Value=4.9) 104 2e-22 SB_42133| Best HMM Match : No HMM Matches (HMM E-Value=.) 104 2e-22 SB_41358| Best HMM Match : No HMM Matches (HMM E-Value=.) 104 2e-22 SB_41085| Best HMM Match : Auxin_repressed (HMM E-Value=9) 104 2e-22 SB_39208| Best HMM Match : No HMM Matches (HMM E-Value=.) 104 2e-22 SB_38558| Best HMM Match : TFIIA_gamma_N (HMM E-Value=7.4) 104 2e-22 SB_36723| Best HMM Match : DUF753 (HMM E-Value=9.9) 104 2e-22 SB_34424| Best HMM Match : RNase_U2 (HMM E-Value=7.5) 104 2e-22 SB_34007| Best HMM Match : No HMM Matches (HMM E-Value=.) 104 2e-22 SB_33833| Best HMM Match : DUF947 (HMM E-Value=0.2) 104 2e-22 SB_32900| Best HMM Match : No HMM Matches (HMM E-Value=.) 104 2e-22 SB_31865| Best HMM Match : No HMM Matches (HMM E-Value=.) 104 2e-22 SB_30521| Best HMM Match : DUF333 (HMM E-Value=9.4) 104 2e-22 SB_29851| Best HMM Match : No HMM Matches (HMM E-Value=.) 104 2e-22 SB_24102| Best HMM Match : DUF753 (HMM E-Value=9.4) 104 2e-22 SB_23875| Best HMM Match : Porin_3 (HMM E-Value=3.22299e-44) 104 2e-22 SB_22914| Best HMM Match : No HMM Matches (HMM E-Value=.) 104 2e-22 SB_21520| Best HMM Match : Trypsin (HMM E-Value=0) 104 2e-22 SB_20904| Best HMM Match : Filament_head (HMM E-Value=10) 104 2e-22 SB_19009| Best HMM Match : Sperm_Ag_HE2 (HMM E-Value=2.3) 104 2e-22 SB_16182| Best HMM Match : No HMM Matches (HMM E-Value=.) 104 2e-22 SB_12140| Best HMM Match : ATP-synt_F (HMM E-Value=0.21) 104 2e-22 SB_12114| Best HMM Match : No HMM Matches (HMM E-Value=.) 104 2e-22 SB_10984| Best HMM Match : No HMM Matches (HMM E-Value=.) 104 2e-22 SB_8429| Best HMM Match : No HMM Matches (HMM E-Value=.) 104 2e-22 SB_5632| Best HMM Match : XRN_N (HMM E-Value=3.9) 104 2e-22 SB_5073| Best HMM Match : Rhomboid (HMM E-Value=3.3) 104 2e-22 SB_4528| Best HMM Match : Antistasin (HMM E-Value=8.4) 104 2e-22 SB_4508| Best HMM Match : No HMM Matches (HMM E-Value=.) 104 2e-22 SB_1283| Best HMM Match : No HMM Matches (HMM E-Value=.) 104 2e-22 SB_1210| Best HMM Match : No HMM Matches (HMM E-Value=.) 104 2e-22 SB_1178| Best HMM Match : No HMM Matches (HMM E-Value=.) 104 2e-22 SB_45645| Best HMM Match : No HMM Matches (HMM E-Value=.) 104 2e-22 SB_259| Best HMM Match : No HMM Matches (HMM E-Value=.) 104 2e-22 SB_59793| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 3e-22 SB_59635| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 3e-22 SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 3e-22 SB_59550| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 3e-22 SB_59504| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 3e-22 SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 3e-22 SB_59286| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 3e-22 SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 3e-22 SB_58987| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 3e-22 SB_58779| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 3e-22 SB_58768| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 3e-22 SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 3e-22 SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 3e-22 SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 3e-22 SB_58651| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 3e-22 SB_58615| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 3e-22 SB_58535| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 3e-22 SB_58509| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 3e-22 SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) 103 3e-22 SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 3e-22 SB_57850| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 3e-22 SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 3e-22 SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) 103 3e-22 SB_57711| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 3e-22 SB_57634| Best HMM Match : EGF_2 (HMM E-Value=0.0014) 103 3e-22 SB_57403| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 3e-22 SB_57371| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 3e-22 SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 3e-22 SB_57287| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 3e-22 SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) 103 3e-22 SB_57194| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 3e-22 SB_57193| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 3e-22 SB_57151| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 3e-22 SB_57135| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 3e-22 SB_57120| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 3e-22 SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 3e-22 SB_56982| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 3e-22 SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 3e-22 SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 3e-22 SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 3e-22 SB_56746| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 3e-22 SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 3e-22 SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 3e-22 SB_56676| Best HMM Match : Peptidase_C1 (HMM E-Value=0.0027) 103 3e-22 SB_56581| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 3e-22 SB_56546| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 3e-22 SB_56496| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 3e-22 SB_56428| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 3e-22 SB_56281| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 3e-22 SB_56027| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 3e-22 SB_56013| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 3e-22 SB_55938| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 3e-22 SB_55868| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 3e-22 SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 3e-22 SB_55798| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 3e-22 SB_55789| Best HMM Match : ERG2_Sigma1R (HMM E-Value=3.6e-10) 103 3e-22 SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 3e-22 SB_55626| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 3e-22 SB_55592| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 3e-22 SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 3e-22 SB_55155| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 3e-22 SB_55099| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 3e-22 SB_55072| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 3e-22 SB_55011| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 3e-22 SB_54989| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 3e-22 SB_54840| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 3e-22 SB_54799| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 3e-22 SB_54578| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 3e-22 SB_54508| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 3e-22 SB_54473| Best HMM Match : DLIC (HMM E-Value=0) 103 3e-22 SB_54247| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 3e-22 SB_54170| Best HMM Match : Coronavirus_NS4 (HMM E-Value=6.1) 103 3e-22 SB_54136| Best HMM Match : YbgT_YccB (HMM E-Value=3) 103 3e-22 SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 3e-22 SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) 103 3e-22 SB_53753| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 3e-22 SB_53666| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 3e-22 SB_53625| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 3e-22 SB_53515| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 3e-22 SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 3e-22 SB_53231| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 3e-22 SB_53118| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 3e-22 SB_52850| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 3e-22 SB_52844| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 3e-22 SB_52789| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 3e-22 SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 3e-22 SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 3e-22 SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 3e-22 SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) 103 3e-22 SB_52427| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 3e-22 SB_52394| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 3e-22 SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 3e-22 SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 3e-22 SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 3e-22 SB_52260| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 3e-22 SB_52253| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 3e-22 SB_52161| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 3e-22 SB_52086| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 3e-22 SB_51989| Best HMM Match : Extensin_2 (HMM E-Value=0.29) 103 3e-22 SB_51427| Best HMM Match : DUF855 (HMM E-Value=4) 103 3e-22 SB_51409| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 3e-22 SB_51320| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 3e-22 SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 3e-22 SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 3e-22 SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) 103 3e-22 SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 3e-22 SB_50493| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 3e-22 SB_50417| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 3e-22 SB_50270| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 3e-22 SB_50195| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 3e-22 SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 3e-22 SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 3e-22 SB_49896| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 3e-22 SB_49839| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 3e-22 SB_49814| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 3e-22 SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 3e-22 SB_49530| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 3e-22 SB_49465| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 3e-22 SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 3e-22 SB_49395| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 3e-22 SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 3e-22 SB_49211| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 3e-22 SB_49150| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 3e-22 SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1) 103 3e-22 SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 3e-22 SB_48522| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 3e-22 SB_48514| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 3e-22 SB_48486| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 3e-22 SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 3e-22 SB_48129| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 3e-22 SB_48100| Best HMM Match : Transformer (HMM E-Value=5.4) 103 3e-22 SB_48066| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 3e-22 SB_48063| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 3e-22 SB_48045| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 3e-22 SB_48039| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 3e-22 SB_48026| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 3e-22 SB_47536| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 3e-22 SB_47480| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 3e-22 SB_47399| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 3e-22 SB_47315| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 3e-22 SB_47213| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 3e-22 SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 3e-22 SB_46889| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 3e-22 SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) 103 3e-22 SB_46651| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 3e-22 SB_46529| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 3e-22 SB_46517| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 3e-22 SB_46424| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 3e-22 SB_46361| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 3e-22 SB_46321| Best HMM Match : DUF765 (HMM E-Value=3.4) 103 3e-22 SB_46303| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 3e-22 SB_45887| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 3e-22 SB_45813| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 3e-22 SB_45524| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 3e-22 SB_45424| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 3e-22 SB_45381| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 3e-22 SB_45068| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 3e-22 SB_44900| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 3e-22 SB_44806| Best HMM Match : Hist_deacetyl (HMM E-Value=0) 103 3e-22 SB_44800| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 3e-22 SB_44789| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 3e-22 SB_44778| Best HMM Match : TPR_2 (HMM E-Value=0.00023) 103 3e-22 SB_44516| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 3e-22 SB_44466| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 3e-22 SB_44411| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 3e-22 SB_44401| Best HMM Match : No HMM Matches (HMM E-Value=.) 103 3e-22 >SB_34678| Best HMM Match : Bromodomain (HMM E-Value=9e-25) Length = 1137 Score = 111 bits (267), Expect = 1e-24 Identities = 54/79 (68%), Positives = 57/79 (72%) Frame = +2 Query: 626 KKKKNSRGGPVXXXXXXXXXXXXLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAP 805 K+ N RG P+ [lacZ-alpha fragment, 36 aa] Sbjct: 508 KESANQRGDPLESTCRHASLA--LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAR 565 Query: 806 HRSPXQQLRSLNGEWQLKR 862 P QQLRSLNGEW+L R Sbjct: 566 TDRPSQQLRSLNGEWRLMR 584 >SB_40566| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 110 bits (264), Expect = 3e-24 Identities = 55/90 (61%), Positives = 62/90 (68%) Frame = +2 Query: 593 NIPNI*EIVLKKKKKNSRGGPVXXXXXXXXXXXXLAVVLQRRDWENPGVTQLNRLAAHPP 772 ++PN+ L ++ RG P+ LAVVLQRRDWENPGVTQLNRLAAHPP Sbjct: 9 SVPNLKGTFLCMQQAAIRGDPLESTCRHASLA--LAVVLQRRDWENPGVTQLNRLAAHPP 66 Query: 773 FASWRNSEEAPHRSPXQQLRSLNGEWQLKR 862 FASWRNSEEA P QQLRSLNGEW+L R Sbjct: 67 FASWRNSEEARTDRPSQQLRSLNGEWRLMR 96 >SB_55030| Best HMM Match : Toxin_27 (HMM E-Value=1.2) Length = 110 Score = 110 bits (264), Expect = 3e-24 Identities = 53/77 (68%), Positives = 58/77 (75%) Frame = +2 Query: 626 KKKKNSRGGPVXXXXXXXXXXXXLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAP 805 K+K ++RG P+ [lacZ-alpha fragment, 36 aa] Sbjct: 34 KRKLSNRGDPLESTCRHASLA--LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAR 91 Query: 806 HRSPXQQLRSLNGEWQL 856 P QQLRSLNGEW+L Sbjct: 92 TDRPSQQLRSLNGEWRL 108 >SB_56660| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 917 Score = 109 bits (263), Expect = 4e-24 Identities = 54/76 (71%), Positives = 56/76 (73%) Frame = +2 Query: 635 KNSRGGPVXXXXXXXXXXXXLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRS 814 K SRG P+ [lacZ-alpha fragment, 36 aa] Sbjct: 815 KPSRGDPLESTCRHASLA--LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR 872 Query: 815 PXQQLRSLNGEWQLKR 862 P QQLRSLNGEW+L R Sbjct: 873 PSQQLRSLNGEWRLMR 888 >SB_8714| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 109 bits (263), Expect = 4e-24 Identities = 56/88 (63%), Positives = 62/88 (70%), Gaps = 1/88 (1%) Frame = +2 Query: 602 NI*EIVLKKKKKNS-RGGPVXXXXXXXXXXXXLAVVLQRRDWENPGVTQLNRLAAHPPFA 778 N I+L+ +K+ RG P+ LAVVLQRRDWENPGVTQLNRLAAHPPFA Sbjct: 6 NTWRILLRNDRKSRHRGDPLESTCRHASLA--LAVVLQRRDWENPGVTQLNRLAAHPPFA 63 Query: 779 SWRNSEEAPHRSPXQQLRSLNGEWQLKR 862 SWRNSEEA P QQLRSLNGEW+L R Sbjct: 64 SWRNSEEARTDRPSQQLRSLNGEWRLMR 91 >SB_6875| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 109 bits (262), Expect = 5e-24 Identities = 53/78 (67%), Positives = 57/78 (73%) Frame = +2 Query: 623 KKKKKNSRGGPVXXXXXXXXXXXX[lacZ-alpha fragment, 36 aa] 802 K K K ++G P+ [lacZ-alpha fragment, 36 aa] Sbjct: 14 KGKAKGTKGDPLESTCRHASLA--LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEA 71 Query: 803 PHRSPXQQLRSLNGEWQL 856 P QQLRSLNGEW+L Sbjct: 72 RTDRPSQQLRSLNGEWRL 89 >SB_55579| Best HMM Match : Rhodanese (HMM E-Value=9.2e-29) Length = 269 Score = 109 bits (261), Expect = 7e-24 Identities = 50/65 (76%), Positives = 53/65 (81%) Frame = -3 Query: 882 RXFYQILRFNCHSPFRLRNCWXGDRCGASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 703 + F+ + HSPFRLRNCW G ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT Sbjct: 205 KNFFNTCKGASHSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKT 264 Query: 702 TASEL 688 TASEL Sbjct: 265 TASEL 269 >SB_17049| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 548 Score = 109 bits (261), Expect = 7e-24 Identities = 50/62 (80%), Positives = 52/62 (83%) Frame = -3 Query: 873 YQILRFNCHSPFRLRNCWXGDRCGASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 694 Y + + HSPFRLRNCW G ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS Sbjct: 487 YDVYQGASHSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 546 Query: 693 EL 688 EL Sbjct: 547 EL 548 >SB_7402| Best HMM Match : Extensin_2 (HMM E-Value=2) Length = 267 Score = 109 bits (261), Expect = 7e-24 Identities = 54/89 (60%), Positives = 59/89 (66%) Frame = +2 Query: 596 IPNI*EIVLKKKKKNSRGGPVXXXXXXXXXXXXLAVVLQRRDWENPGVTQLNRLAAHPPF 775 +P+ +VL+ KK LAVVLQRRDWENPGVTQLNRLAAHPPF Sbjct: 8 VPSFFVLVLRNTKKLPYRNGDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHPPF 67 Query: 776 ASWRNSEEAPHRSPXQQLRSLNGEWQLKR 862 ASWRNSEEA P QQLRSLNGEW+L R Sbjct: 68 ASWRNSEEARTDRPSQQLRSLNGEWRLMR 96 >SB_6842| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 107 Score = 108 bits (260), Expect = 9e-24 Identities = 53/77 (68%), Positives = 56/77 (72%) Frame = +2 Query: 632 KKNSRGGPVXXXXXXXXXXXXLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHR 811 K + RG P+ [lacZ-alpha fragment, 36 aa] Sbjct: 18 KSSLRGDPLESTCRHASLA--LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTD 75 Query: 812 SPXQQLRSLNGEWQLKR 862 P QQLRSLNGEW+L R Sbjct: 76 RPSQQLRSLNGEWRLMR 92 >SB_41244| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 268 Score = 108 bits (260), Expect = 9e-24 Identities = 52/77 (67%), Positives = 57/77 (74%) Frame = +2 Query: 632 KKNSRGGPVXXXXXXXXXXXXLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHR 811 ++N +G P+ [lacZ-alpha fragment, 36 aa] Sbjct: 185 EENPKGDPLESTCRHASLA--LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTD 242 Query: 812 SPXQQLRSLNGEWQLKR 862 P QQLRSLNGEW+L R Sbjct: 243 RPSQQLRSLNGEWRLMR 259 >SB_47732| Best HMM Match : Pkinase (HMM E-Value=0.0016) Length = 318 Score = 108 bits (259), Expect = 1e-23 Identities = 53/77 (68%), Positives = 55/77 (71%) Frame = +2 Query: 632 KKNSRGGPVXXXXXXXXXXXXLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHR 811 K N+R G [lacZ-alpha fragment, 36 aa] Sbjct: 80 KSNARAGDPLESTCRHASLA-LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTD 138 Query: 812 SPXQQLRSLNGEWQLKR 862 P QQLRSLNGEW+L R Sbjct: 139 RPSQQLRSLNGEWRLMR 155 >SB_8582| Best HMM Match : CsgG (HMM E-Value=4.9e-06) Length = 233 Score = 108 bits (259), Expect = 1e-23 Identities = 54/82 (65%), Positives = 58/82 (70%) Frame = +2 Query: 617 VLKKKKKNSRGGPVXXXXXXXXXXXXLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 796 +L K + S G P+ LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE Sbjct: 128 ILVKYRHMSVGDPLESTCRHASLA--LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSE 185 Query: 797 EAPHRSPXQQLRSLNGEWQLKR 862 EA P QQLRSLNGEW+L R Sbjct: 186 EARTDRPSQQLRSLNGEWRLMR 207 >SB_40229| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 108 bits (259), Expect = 1e-23 Identities = 54/91 (59%), Positives = 59/91 (64%) Frame = +2 Query: 590 LNIPNI*EIVLKKKKKNSRGGPVXXXXXXXXXXXXLAVVLQRRDWENPGVTQLNRLAAHP 769 L P+ + +KK + G LAVVLQRRDWENPGVTQLNRLAAHP Sbjct: 28 LGTPSALNVKVKKFNQARVNGGDPLESTCRHASLALAVVLQRRDWENPGVTQLNRLAAHP 87 Query: 770 PFASWRNSEEAPHRSPXQQLRSLNGEWQLKR 862 PFASWRNSEEA P QQLRSLNGEW+L R Sbjct: 88 PFASWRNSEEARTDRPSQQLRSLNGEWRLMR 118 >SB_46589| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 562 Score = 107 bits (258), Expect = 2e-23 Identities = 53/83 (63%), Positives = 58/83 (69%) Frame = +2 Query: 614 IVLKKKKKNSRGGPVXXXXXXXXXXXXLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 793 +V+ K + G P+ LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS Sbjct: 121 LVIIGKVREESGDPLESTCRHASLA--LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNS 178 Query: 794 EEAPHRSPXQQLRSLNGEWQLKR 862 EEA P QQLRSLNGEW+L R Sbjct: 179 EEARTDRPSQQLRSLNGEWRLMR 201 >SB_46308| Best HMM Match : IMS (HMM E-Value=0) Length = 1245 Score = 107 bits (258), Expect = 2e-23 Identities = 51/77 (66%), Positives = 56/77 (72%) Frame = +2 Query: 626 KKKKNSRGGPVXXXXXXXXXXXXLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAP 805 K++ +G P+ [lacZ-alpha fragment, 36 aa] Sbjct: 1169 KRRSQGKGDPLESTCRHASLA--LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAR 1226 Query: 806 HRSPXQQLRSLNGEWQL 856 P QQLRSLNGEW+L Sbjct: 1227 TDRPSQQLRSLNGEWRL 1243 Score = 70.5 bits (165), Expect = 3e-12 Identities = 31/36 (86%), Positives = 31/36 (86%) Frame = -3 Query: 849 HSPFRLRNCWXGDRCGASSLLRQLAKGGCAARRLSW 742 HSPFRLRNCW G ASSLLRQLAKGGCAARRLSW Sbjct: 404 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSW 439 >SB_44358| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 107 bits (258), Expect = 2e-23 Identities = 52/75 (69%), Positives = 56/75 (74%) Frame = +2 Query: 638 NSRGGPVXXXXXXXXXXXXLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSP 817 ++RG P+ [lacZ-alpha fragment, 36 aa] P Sbjct: 79 STRGDPLESTCRHASLA--LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRP 136 Query: 818 XQQLRSLNGEWQLKR 862 QQLRSLNGEW+L R Sbjct: 137 SQQLRSLNGEWRLMR 151 >SB_33270| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 107 bits (258), Expect = 2e-23 Identities = 52/81 (64%), Positives = 57/81 (70%) Frame = +2 Query: 620 LKKKKKNSRGGPVXXXXXXXXXXXXLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 799 + K + +G P+ LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE Sbjct: 47 ISNKPASRKGDPLESTCRHASLA--LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 104 Query: 800 APHRSPXQQLRSLNGEWQLKR 862 A P QQLRSLNGEW+L R Sbjct: 105 ARTDRPSQQLRSLNGEWRLMR 125 >SB_22440| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 107 bits (258), Expect = 2e-23 Identities = 52/77 (67%), Positives = 55/77 (71%) Frame = +2 Query: 632 KKNSRGGPVXXXXXXXXXXXXLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHR 811 +K G P+ [lacZ-alpha fragment, 36 aa] Sbjct: 2 RKGEEGDPLESTCRHASLA--LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTD 59 Query: 812 SPXQQLRSLNGEWQLKR 862 P QQLRSLNGEW+L R Sbjct: 60 RPSQQLRSLNGEWRLMR 76 >SB_20378| Best HMM Match : Adeno_E1B_19K (HMM E-Value=5.7) Length = 132 Score = 107 bits (258), Expect = 2e-23 Identities = 52/61 (85%), Positives = 53/61 (86%), Gaps = 3/61 (4%) Frame = +2 Query: 695 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPXQQLRSLNGEWQL---KRN 865 [lacZ-alpha fragment, 36 aa] P QQLRSLNGEW+L KRN Sbjct: 51 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRTKRN 110 Query: 866 I 868 I Sbjct: 111 I 111 >SB_59624| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 107 bits (257), Expect = 2e-23 Identities = 49/56 (87%), Positives = 50/56 (89%) Frame = +2 Query: 695 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPXQQLRSLNGEWQLKR 862 [lacZ-alpha fragment, 36 aa] P QQLRSLNGEW+L R Sbjct: 62 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMR 117 >SB_58792| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 107 bits (257), Expect = 2e-23 Identities = 49/54 (90%), Positives = 49/54 (90%) Frame = -3 Query: 849 HSPFRLRNCWXGDRCGASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 688 HSPFRLRNCW G ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 4 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 57 >SB_58723| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 107 bits (257), Expect = 2e-23 Identities = 49/56 (87%), Positives = 50/56 (89%) Frame = +2 Query: 695 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPXQQLRSLNGEWQLKR 862 [lacZ-alpha fragment, 36 aa] P QQLRSLNGEW+L R Sbjct: 25 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMR 80 >SB_58076| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 107 bits (257), Expect = 2e-23 Identities = 49/56 (87%), Positives = 50/56 (89%) Frame = +2 Query: 695 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPXQQLRSLNGEWQLKR 862 [lacZ-alpha fragment, 36 aa] P QQLRSLNGEW+L R Sbjct: 49 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMR 104 >SB_57885| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 118 Score = 107 bits (257), Expect = 2e-23 Identities = 49/56 (87%), Positives = 50/56 (89%) Frame = +2 Query: 695 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPXQQLRSLNGEWQLKR 862 [lacZ-alpha fragment, 36 aa] P QQLRSLNGEW+L R Sbjct: 28 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMR 83 >SB_55921| Best HMM Match : Aldo_ket_red (HMM E-Value=0.16) Length = 195 Score = 107 bits (257), Expect = 2e-23 Identities = 49/56 (87%), Positives = 50/56 (89%) Frame = +2 Query: 695 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPXQQLRSLNGEWQLKR 862 [lacZ-alpha fragment, 36 aa] P QQLRSLNGEW+L R Sbjct: 114 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMR 169 >SB_55719| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 107 bits (257), Expect = 2e-23 Identities = 49/56 (87%), Positives = 50/56 (89%) Frame = +2 Query: 695 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPXQQLRSLNGEWQLKR 862 [lacZ-alpha fragment, 36 aa] P QQLRSLNGEW+L R Sbjct: 39 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMR 94 >SB_55288| Best HMM Match : TLD (HMM E-Value=0.00092) Length = 349 Score = 107 bits (257), Expect = 2e-23 Identities = 49/56 (87%), Positives = 50/56 (89%) Frame = +2 Query: 695 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPXQQLRSLNGEWQLKR 862 [lacZ-alpha fragment, 36 aa] P QQLRSLNGEW+L R Sbjct: 11 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMR 66 >SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 107 bits (257), Expect = 2e-23 Identities = 49/56 (87%), Positives = 50/56 (89%) Frame = +2 Query: 695 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPXQQLRSLNGEWQLKR 862 [lacZ-alpha fragment, 36 aa] P QQLRSLNGEW+L R Sbjct: 88 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMR 143 >SB_52130| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 107 bits (257), Expect = 2e-23 Identities = 49/56 (87%), Positives = 50/56 (89%) Frame = +2 Query: 695 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPXQQLRSLNGEWQLKR 862 [lacZ-alpha fragment, 36 aa] P QQLRSLNGEW+L R Sbjct: 22 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMR 77 >SB_52085| Best HMM Match : TIL (HMM E-Value=2.5) Length = 234 Score = 107 bits (257), Expect = 2e-23 Identities = 49/56 (87%), Positives = 50/56 (89%) Frame = +2 Query: 695 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPXQQLRSLNGEWQLKR 862 [lacZ-alpha fragment, 36 aa] P QQLRSLNGEW+L R Sbjct: 153 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMR 208 >SB_51638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 107 bits (257), Expect = 2e-23 Identities = 49/56 (87%), Positives = 50/56 (89%) Frame = +2 Query: 695 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPXQQLRSLNGEWQLKR 862 [lacZ-alpha fragment, 36 aa] P QQLRSLNGEW+L R Sbjct: 57 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMR 112 >SB_50850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 107 bits (257), Expect = 2e-23 Identities = 49/56 (87%), Positives = 50/56 (89%) Frame = +2 Query: 695 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPXQQLRSLNGEWQLKR 862 [lacZ-alpha fragment, 36 aa] P QQLRSLNGEW+L R Sbjct: 60 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMR 115 >SB_49644| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1615 Score = 107 bits (257), Expect = 2e-23 Identities = 49/56 (87%), Positives = 50/56 (89%) Frame = +2 Query: 695 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPXQQLRSLNGEWQLKR 862 [lacZ-alpha fragment, 36 aa] P QQLRSLNGEW+L R Sbjct: 213 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMR 268 >SB_49495| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 118 Score = 107 bits (257), Expect = 2e-23 Identities = 49/56 (87%), Positives = 50/56 (89%) Frame = +2 Query: 695 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPXQQLRSLNGEWQLKR 862 [lacZ-alpha fragment, 36 aa] P QQLRSLNGEW+L R Sbjct: 48 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMR 103 >SB_49117| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 121 Score = 107 bits (257), Expect = 2e-23 Identities = 49/56 (87%), Positives = 50/56 (89%) Frame = +2 Query: 695 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPXQQLRSLNGEWQLKR 862 [lacZ-alpha fragment, 36 aa] P QQLRSLNGEW+L R Sbjct: 40 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMR 95 >SB_49064| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 107 bits (257), Expect = 2e-23 Identities = 49/56 (87%), Positives = 50/56 (89%) Frame = +2 Query: 695 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPXQQLRSLNGEWQLKR 862 [lacZ-alpha fragment, 36 aa] P QQLRSLNGEW+L R Sbjct: 75 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMR 130 >SB_48393| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 107 bits (257), Expect = 2e-23 Identities = 49/56 (87%), Positives = 50/56 (89%) Frame = +2 Query: 695 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPXQQLRSLNGEWQLKR 862 [lacZ-alpha fragment, 36 aa] P QQLRSLNGEW+L R Sbjct: 22 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMR 77 >SB_47872| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 107 bits (257), Expect = 2e-23 Identities = 49/56 (87%), Positives = 50/56 (89%) Frame = +2 Query: 695 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPXQQLRSLNGEWQLKR 862 [lacZ-alpha fragment, 36 aa] P QQLRSLNGEW+L R Sbjct: 57 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMR 112 >SB_47291| Best HMM Match : PilN (HMM E-Value=0.75) Length = 424 Score = 107 bits (257), Expect = 2e-23 Identities = 49/54 (90%), Positives = 49/54 (90%) Frame = -3 Query: 849 HSPFRLRNCWXGDRCGASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 688 HSPFRLRNCW G ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 371 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 424 >SB_47276| Best HMM Match : DUF851 (HMM E-Value=9.6) Length = 154 Score = 107 bits (257), Expect = 2e-23 Identities = 49/56 (87%), Positives = 50/56 (89%) Frame = +2 Query: 695 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPXQQLRSLNGEWQLKR 862 [lacZ-alpha fragment, 36 aa] P QQLRSLNGEW+L R Sbjct: 73 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMR 128 >SB_46649| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 107 bits (257), Expect = 2e-23 Identities = 49/56 (87%), Positives = 50/56 (89%) Frame = +2 Query: 695 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPXQQLRSLNGEWQLKR 862 [lacZ-alpha fragment, 36 aa] P QQLRSLNGEW+L R Sbjct: 28 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMR 83 >SB_46412| Best HMM Match : HEAT (HMM E-Value=8) Length = 140 Score = 107 bits (257), Expect = 2e-23 Identities = 49/56 (87%), Positives = 50/56 (89%) Frame = +2 Query: 695 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPXQQLRSLNGEWQLKR 862 [lacZ-alpha fragment, 36 aa] P QQLRSLNGEW+L R Sbjct: 59 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMR 114 >SB_46374| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 107 bits (257), Expect = 2e-23 Identities = 49/56 (87%), Positives = 50/56 (89%) Frame = +2 Query: 695 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPXQQLRSLNGEWQLKR 862 [lacZ-alpha fragment, 36 aa] P QQLRSLNGEW+L R Sbjct: 88 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMR 143 >SB_46344| Best HMM Match : ig (HMM E-Value=0.0082) Length = 181 Score = 107 bits (257), Expect = 2e-23 Identities = 49/56 (87%), Positives = 50/56 (89%) Frame = +2 Query: 695 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPXQQLRSLNGEWQLKR 862 [lacZ-alpha fragment, 36 aa] P QQLRSLNGEW+L R Sbjct: 100 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMR 155 >SB_46194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 107 bits (257), Expect = 2e-23 Identities = 49/56 (87%), Positives = 50/56 (89%) Frame = +2 Query: 695 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPXQQLRSLNGEWQLKR 862 [lacZ-alpha fragment, 36 aa] P QQLRSLNGEW+L R Sbjct: 32 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMR 87 >SB_45914| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 206 Score = 107 bits (257), Expect = 2e-23 Identities = 49/56 (87%), Positives = 50/56 (89%) Frame = +2 Query: 695 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPXQQLRSLNGEWQLKR 862 [lacZ-alpha fragment, 36 aa] P QQLRSLNGEW+L R Sbjct: 125 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMR 180 >SB_43671| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 107 bits (257), Expect = 2e-23 Identities = 49/56 (87%), Positives = 50/56 (89%) Frame = +2 Query: 695 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPXQQLRSLNGEWQLKR 862 [lacZ-alpha fragment, 36 aa] P QQLRSLNGEW+L R Sbjct: 61 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMR 116 >SB_43630| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 107 bits (257), Expect = 2e-23 Identities = 49/56 (87%), Positives = 50/56 (89%) Frame = +2 Query: 695 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPXQQLRSLNGEWQLKR 862 [lacZ-alpha fragment, 36 aa] P QQLRSLNGEW+L R Sbjct: 84 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMR 139 >SB_43145| Best HMM Match : PEGSRP (HMM E-Value=7.2) Length = 165 Score = 107 bits (257), Expect = 2e-23 Identities = 49/56 (87%), Positives = 50/56 (89%) Frame = +2 Query: 695 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPXQQLRSLNGEWQLKR 862 [lacZ-alpha fragment, 36 aa] P QQLRSLNGEW+L R Sbjct: 84 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMR 139 >SB_42949| Best HMM Match : SRCR (HMM E-Value=1.6e-14) Length = 340 Score = 107 bits (257), Expect = 2e-23 Identities = 49/54 (90%), Positives = 49/54 (90%) Frame = -3 Query: 849 HSPFRLRNCWXGDRCGASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 688 HSPFRLRNCW G ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 287 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 340 >SB_42831| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 107 bits (257), Expect = 2e-23 Identities = 49/56 (87%), Positives = 50/56 (89%) Frame = +2 Query: 695 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPXQQLRSLNGEWQLKR 862 [lacZ-alpha fragment, 36 aa] P QQLRSLNGEW+L R Sbjct: 84 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMR 139 >SB_42655| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 107 bits (257), Expect = 2e-23 Identities = 49/56 (87%), Positives = 50/56 (89%) Frame = +2 Query: 695 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPXQQLRSLNGEWQLKR 862 [lacZ-alpha fragment, 36 aa] P QQLRSLNGEW+L R Sbjct: 65 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMR 120 >SB_42158| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 114 Score = 107 bits (257), Expect = 2e-23 Identities = 49/56 (87%), Positives = 50/56 (89%) Frame = +2 Query: 695 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPXQQLRSLNGEWQLKR 862 [lacZ-alpha fragment, 36 aa] P QQLRSLNGEW+L R Sbjct: 24 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMR 79 >SB_42069| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 189 Score = 107 bits (257), Expect = 2e-23 Identities = 49/56 (87%), Positives = 50/56 (89%) Frame = +2 Query: 695 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPXQQLRSLNGEWQLKR 862 [lacZ-alpha fragment, 36 aa] P QQLRSLNGEW+L R Sbjct: 108 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMR 163 >SB_41728| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 94 Score = 107 bits (257), Expect = 2e-23 Identities = 49/56 (87%), Positives = 50/56 (89%) Frame = +2 Query: 695 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPXQQLRSLNGEWQLKR 862 [lacZ-alpha fragment, 36 aa] P QQLRSLNGEW+L R Sbjct: 24 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMR 79 >SB_41712| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 198 Score = 107 bits (257), Expect = 2e-23 Identities = 49/56 (87%), Positives = 50/56 (89%) Frame = +2 Query: 695 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPXQQLRSLNGEWQLKR 862 [lacZ-alpha fragment, 36 aa] P QQLRSLNGEW+L R Sbjct: 43 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMR 98 >SB_41481| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 157 Score = 107 bits (257), Expect = 2e-23 Identities = 49/56 (87%), Positives = 50/56 (89%) Frame = +2 Query: 695 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPXQQLRSLNGEWQLKR 862 [lacZ-alpha fragment, 36 aa] P QQLRSLNGEW+L R Sbjct: 76 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMR 131 >SB_40939| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 107 bits (257), Expect = 2e-23 Identities = 49/56 (87%), Positives = 50/56 (89%) Frame = +2 Query: 695 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPXQQLRSLNGEWQLKR 862 [lacZ-alpha fragment, 36 aa] P QQLRSLNGEW+L R Sbjct: 67 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMR 122 >SB_40610| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 172 Score = 107 bits (257), Expect = 2e-23 Identities = 49/56 (87%), Positives = 50/56 (89%) Frame = +2 Query: 695 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPXQQLRSLNGEWQLKR 862 [lacZ-alpha fragment, 36 aa] P QQLRSLNGEW+L R Sbjct: 91 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMR 146 >SB_40462| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1580 Score = 107 bits (257), Expect = 2e-23 Identities = 49/56 (87%), Positives = 50/56 (89%) Frame = +2 Query: 695 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPXQQLRSLNGEWQLKR 862 [lacZ-alpha fragment, 36 aa] P QQLRSLNGEW+L R Sbjct: 1063 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMR 1118 >SB_38016| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 215 Score = 107 bits (257), Expect = 2e-23 Identities = 49/56 (87%), Positives = 50/56 (89%) Frame = +2 Query: 695 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPXQQLRSLNGEWQLKR 862 [lacZ-alpha fragment, 36 aa] P QQLRSLNGEW+L R Sbjct: 134 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMR 189 >SB_37690| Best HMM Match : IgG_binding_B (HMM E-Value=4.2) Length = 263 Score = 107 bits (257), Expect = 2e-23 Identities = 49/56 (87%), Positives = 50/56 (89%) Frame = +2 Query: 695 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPXQQLRSLNGEWQLKR 862 [lacZ-alpha fragment, 36 aa] P QQLRSLNGEW+L R Sbjct: 182 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMR 237 >SB_37661| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 397 Score = 107 bits (257), Expect = 2e-23 Identities = 49/56 (87%), Positives = 50/56 (89%) Frame = +2 Query: 695 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPXQQLRSLNGEWQLKR 862 [lacZ-alpha fragment, 36 aa] P QQLRSLNGEW+L R Sbjct: 170 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMR 225 >SB_37536| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 107 bits (257), Expect = 2e-23 Identities = 49/56 (87%), Positives = 50/56 (89%) Frame = +2 Query: 695 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPXQQLRSLNGEWQLKR 862 [lacZ-alpha fragment, 36 aa] P QQLRSLNGEW+L R Sbjct: 59 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMR 114 >SB_37245| Best HMM Match : Disintegrin (HMM E-Value=7.9) Length = 227 Score = 107 bits (257), Expect = 2e-23 Identities = 49/56 (87%), Positives = 50/56 (89%) Frame = +2 Query: 695 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPXQQLRSLNGEWQLKR 862 [lacZ-alpha fragment, 36 aa] P QQLRSLNGEW+L R Sbjct: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMR 201 >SB_36865| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 107 bits (257), Expect = 2e-23 Identities = 49/56 (87%), Positives = 50/56 (89%) Frame = +2 Query: 695 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPXQQLRSLNGEWQLKR 862 [lacZ-alpha fragment, 36 aa] P QQLRSLNGEW+L R Sbjct: 58 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMR 113 >SB_35997| Best HMM Match : Phage_fiber (HMM E-Value=0.78) Length = 197 Score = 107 bits (257), Expect = 2e-23 Identities = 49/56 (87%), Positives = 50/56 (89%) Frame = +2 Query: 695 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPXQQLRSLNGEWQLKR 862 [lacZ-alpha fragment, 36 aa] P QQLRSLNGEW+L R Sbjct: 116 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMR 171 >SB_35689| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 107 bits (257), Expect = 2e-23 Identities = 49/56 (87%), Positives = 50/56 (89%) Frame = +2 Query: 695 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPXQQLRSLNGEWQLKR 862 [lacZ-alpha fragment, 36 aa] P QQLRSLNGEW+L R Sbjct: 23 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMR 78 >SB_35257| Best HMM Match : Sec8_exocyst (HMM E-Value=0.59) Length = 1060 Score = 107 bits (257), Expect = 2e-23 Identities = 49/56 (87%), Positives = 50/56 (89%) Frame = +2 Query: 695 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPXQQLRSLNGEWQLKR 862 [lacZ-alpha fragment, 36 aa] P QQLRSLNGEW+L R Sbjct: 652 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMR 707 >SB_34829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 107 bits (257), Expect = 2e-23 Identities = 49/56 (87%), Positives = 50/56 (89%) Frame = +2 Query: 695 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPXQQLRSLNGEWQLKR 862 [lacZ-alpha fragment, 36 aa] P QQLRSLNGEW+L R Sbjct: 39 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMR 94 >SB_34793| Best HMM Match : TIL (HMM E-Value=4.5) Length = 242 Score = 107 bits (257), Expect = 2e-23 Identities = 49/56 (87%), Positives = 50/56 (89%) Frame = +2 Query: 695 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPXQQLRSLNGEWQLKR 862 [lacZ-alpha fragment, 36 aa] P QQLRSLNGEW+L R Sbjct: 161 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMR 216 >SB_34015| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 107 bits (257), Expect = 2e-23 Identities = 49/56 (87%), Positives = 50/56 (89%) Frame = +2 Query: 695 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPXQQLRSLNGEWQLKR 862 [lacZ-alpha fragment, 36 aa] P QQLRSLNGEW+L R Sbjct: 22 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMR 77 >SB_32411| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 107 bits (257), Expect = 2e-23 Identities = 49/56 (87%), Positives = 50/56 (89%) Frame = +2 Query: 695 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPXQQLRSLNGEWQLKR 862 [lacZ-alpha fragment, 36 aa] P QQLRSLNGEW+L R Sbjct: 71 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMR 126 >SB_32110| Best HMM Match : PEGSRP (HMM E-Value=9.6) Length = 160 Score = 107 bits (257), Expect = 2e-23 Identities = 49/56 (87%), Positives = 50/56 (89%) Frame = +2 Query: 695 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPXQQLRSLNGEWQLKR 862 [lacZ-alpha fragment, 36 aa] P QQLRSLNGEW+L R Sbjct: 79 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMR 134 >SB_31658| Best HMM Match : Arm (HMM E-Value=0.91) Length = 249 Score = 107 bits (257), Expect = 2e-23 Identities = 49/56 (87%), Positives = 50/56 (89%) Frame = +2 Query: 695 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPXQQLRSLNGEWQLKR 862 [lacZ-alpha fragment, 36 aa] P QQLRSLNGEW+L R Sbjct: 185 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMR 240 >SB_31511| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 372 Score = 107 bits (257), Expect = 2e-23 Identities = 49/54 (90%), Positives = 49/54 (90%) Frame = -3 Query: 849 HSPFRLRNCWXGDRCGASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 688 HSPFRLRNCW G ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 4 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 57 >SB_31227| Best HMM Match : RIO1 (HMM E-Value=0.13) Length = 633 Score = 107 bits (257), Expect = 2e-23 Identities = 49/56 (87%), Positives = 50/56 (89%) Frame = +2 Query: 695 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPXQQLRSLNGEWQLKR 862 [lacZ-alpha fragment, 36 aa] P QQLRSLNGEW+L R Sbjct: 444 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMR 499 >SB_31056| Best HMM Match : Virus_P-coat (HMM E-Value=6.4) Length = 154 Score = 107 bits (257), Expect = 2e-23 Identities = 49/56 (87%), Positives = 50/56 (89%) Frame = +2 Query: 695 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPXQQLRSLNGEWQLKR 862 [lacZ-alpha fragment, 36 aa] P QQLRSLNGEW+L R Sbjct: 73 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMR 128 >SB_30810| Best HMM Match : JmjC (HMM E-Value=0.0021) Length = 546 Score = 107 bits (257), Expect = 2e-23 Identities = 49/56 (87%), Positives = 50/56 (89%) Frame = +2 Query: 695 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPXQQLRSLNGEWQLKR 862 [lacZ-alpha fragment, 36 aa] P QQLRSLNGEW+L R Sbjct: 266 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMR 321 >SB_30192| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 107 bits (257), Expect = 2e-23 Identities = 49/56 (87%), Positives = 50/56 (89%) Frame = +2 Query: 695 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPXQQLRSLNGEWQLKR 862 [lacZ-alpha fragment, 36 aa] P QQLRSLNGEW+L R Sbjct: 34 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMR 89 >SB_28922| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 107 bits (257), Expect = 2e-23 Identities = 49/56 (87%), Positives = 50/56 (89%) Frame = +2 Query: 695 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPXQQLRSLNGEWQLKR 862 [lacZ-alpha fragment, 36 aa] P QQLRSLNGEW+L R Sbjct: 70 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMR 125 >SB_28866| Best HMM Match : PhdYeFM (HMM E-Value=8.3) Length = 185 Score = 107 bits (257), Expect = 2e-23 Identities = 49/56 (87%), Positives = 50/56 (89%) Frame = +2 Query: 695 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPXQQLRSLNGEWQLKR 862 [lacZ-alpha fragment, 36 aa] P QQLRSLNGEW+L R Sbjct: 104 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMR 159 >SB_28269| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 107 bits (257), Expect = 2e-23 Identities = 49/56 (87%), Positives = 50/56 (89%) Frame = +2 Query: 695 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPXQQLRSLNGEWQLKR 862 [lacZ-alpha fragment, 36 aa] P QQLRSLNGEW+L R Sbjct: 63 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMR 118 >SB_27927| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 107 bits (257), Expect = 2e-23 Identities = 49/56 (87%), Positives = 50/56 (89%) Frame = +2 Query: 695 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPXQQLRSLNGEWQLKR 862 [lacZ-alpha fragment, 36 aa] P QQLRSLNGEW+L R Sbjct: 73 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMR 128 >SB_27779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 107 bits (257), Expect = 2e-23 Identities = 49/56 (87%), Positives = 50/56 (89%) Frame = +2 Query: 695 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPXQQLRSLNGEWQLKR 862 [lacZ-alpha fragment, 36 aa] P QQLRSLNGEW+L R Sbjct: 73 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMR 128 >SB_27047| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 107 bits (257), Expect = 2e-23 Identities = 49/56 (87%), Positives = 50/56 (89%) Frame = +2 Query: 695 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPXQQLRSLNGEWQLKR 862 [lacZ-alpha fragment, 36 aa] P QQLRSLNGEW+L R Sbjct: 74 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMR 129 >SB_26995| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 107 bits (257), Expect = 2e-23 Identities = 49/54 (90%), Positives = 49/54 (90%) Frame = -3 Query: 849 HSPFRLRNCWXGDRCGASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 688 HSPFRLRNCW G ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 4 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 57 >SB_25936| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 164 Score = 107 bits (257), Expect = 2e-23 Identities = 49/56 (87%), Positives = 50/56 (89%) Frame = +2 Query: 695 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPXQQLRSLNGEWQLKR 862 [lacZ-alpha fragment, 36 aa] P QQLRSLNGEW+L R Sbjct: 83 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMR 138 >SB_24859| Best HMM Match : HAP (HMM E-Value=6.4) Length = 257 Score = 107 bits (257), Expect = 2e-23 Identities = 49/56 (87%), Positives = 50/56 (89%) Frame = +2 Query: 695 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPXQQLRSLNGEWQLKR 862 [lacZ-alpha fragment, 36 aa] P QQLRSLNGEW+L R Sbjct: 176 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMR 231 >SB_24787| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 112 Score = 107 bits (257), Expect = 2e-23 Identities = 49/56 (87%), Positives = 50/56 (89%) Frame = +2 Query: 695 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPXQQLRSLNGEWQLKR 862 [lacZ-alpha fragment, 36 aa] P QQLRSLNGEW+L R Sbjct: 31 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMR 86 >SB_24544| Best HMM Match : PSCyt1 (HMM E-Value=4.3) Length = 164 Score = 107 bits (257), Expect = 2e-23 Identities = 49/56 (87%), Positives = 50/56 (89%) Frame = +2 Query: 695 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPXQQLRSLNGEWQLKR 862 [lacZ-alpha fragment, 36 aa] P QQLRSLNGEW+L R Sbjct: 83 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMR 138 >SB_23437| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 107 bits (257), Expect = 2e-23 Identities = 49/56 (87%), Positives = 50/56 (89%) Frame = +2 Query: 695 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPXQQLRSLNGEWQLKR 862 [lacZ-alpha fragment, 36 aa] P QQLRSLNGEW+L R Sbjct: 49 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMR 104 >SB_22254| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 107 bits (257), Expect = 2e-23 Identities = 49/56 (87%), Positives = 50/56 (89%) Frame = +2 Query: 695 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPXQQLRSLNGEWQLKR 862 [lacZ-alpha fragment, 36 aa] P QQLRSLNGEW+L R Sbjct: 68 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMR 123 >SB_21247| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 107 bits (257), Expect = 2e-23 Identities = 49/56 (87%), Positives = 50/56 (89%) Frame = +2 Query: 695 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPXQQLRSLNGEWQLKR 862 [lacZ-alpha fragment, 36 aa] P QQLRSLNGEW+L R Sbjct: 57 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMR 112 >SB_20900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 107 bits (257), Expect = 2e-23 Identities = 49/54 (90%), Positives = 49/54 (90%) Frame = -3 Query: 849 HSPFRLRNCWXGDRCGASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 688 HSPFRLRNCW G ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 4 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 57 >SB_20864| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 107 bits (257), Expect = 2e-23 Identities = 49/56 (87%), Positives = 50/56 (89%) Frame = +2 Query: 695 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPXQQLRSLNGEWQLKR 862 [lacZ-alpha fragment, 36 aa] P QQLRSLNGEW+L R Sbjct: 69 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMR 124 >SB_20814| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 107 bits (257), Expect = 2e-23 Identities = 49/54 (90%), Positives = 49/54 (90%) Frame = -3 Query: 849 HSPFRLRNCWXGDRCGASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 688 HSPFRLRNCW G ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 27 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 80 >SB_19461| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 108 Score = 107 bits (257), Expect = 2e-23 Identities = 49/56 (87%), Positives = 50/56 (89%) Frame = +2 Query: 695 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPXQQLRSLNGEWQLKR 862 [lacZ-alpha fragment, 36 aa] P QQLRSLNGEW+L R Sbjct: 38 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMR 93 >SB_18812| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 107 bits (257), Expect = 2e-23 Identities = 49/56 (87%), Positives = 50/56 (89%) Frame = +2 Query: 695 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPXQQLRSLNGEWQLKR 862 [lacZ-alpha fragment, 36 aa] P QQLRSLNGEW+L R Sbjct: 44 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMR 99 >SB_18289| Best HMM Match : IgG_binding_B (HMM E-Value=7) Length = 143 Score = 107 bits (257), Expect = 2e-23 Identities = 49/56 (87%), Positives = 50/56 (89%) Frame = +2 Query: 695 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPXQQLRSLNGEWQLKR 862 [lacZ-alpha fragment, 36 aa] P QQLRSLNGEW+L R Sbjct: 62 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMR 117 >SB_17565| Best HMM Match : EGF (HMM E-Value=5.1e-05) Length = 162 Score = 107 bits (257), Expect = 2e-23 Identities = 49/56 (87%), Positives = 50/56 (89%) Frame = +2 Query: 695 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPXQQLRSLNGEWQLKR 862 [lacZ-alpha fragment, 36 aa] P QQLRSLNGEW+L R Sbjct: 81 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMR 136 >SB_16725| Best HMM Match : DAGAT (HMM E-Value=1e-39) Length = 571 Score = 107 bits (257), Expect = 2e-23 Identities = 49/56 (87%), Positives = 50/56 (89%) Frame = +2 Query: 695 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPXQQLRSLNGEWQLKR 862 [lacZ-alpha fragment, 36 aa] P QQLRSLNGEW+L R Sbjct: 191 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMR 246 >SB_16155| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 168 Score = 107 bits (257), Expect = 2e-23 Identities = 49/56 (87%), Positives = 50/56 (89%) Frame = +2 Query: 695 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPXQQLRSLNGEWQLKR 862 [lacZ-alpha fragment, 36 aa] P QQLRSLNGEW+L R Sbjct: 87 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMR 142 >SB_15873| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 185 Score = 107 bits (257), Expect = 2e-23 Identities = 49/56 (87%), Positives = 50/56 (89%) Frame = +2 Query: 695 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPXQQLRSLNGEWQLKR 862 [lacZ-alpha fragment, 36 aa] P QQLRSLNGEW+L R Sbjct: 104 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMR 159 >SB_15493| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 108 Score = 107 bits (257), Expect = 2e-23 Identities = 49/56 (87%), Positives = 50/56 (89%) Frame = +2 Query: 695 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPXQQLRSLNGEWQLKR 862 [lacZ-alpha fragment, 36 aa] P QQLRSLNGEW+L R Sbjct: 38 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMR 93 >SB_15346| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 107 bits (257), Expect = 2e-23 Identities = 49/56 (87%), Positives = 50/56 (89%) Frame = +2 Query: 695 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPXQQLRSLNGEWQLKR 862 [lacZ-alpha fragment, 36 aa] P QQLRSLNGEW+L R Sbjct: 50 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMR 105 >SB_15295| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 107 bits (257), Expect = 2e-23 Identities = 49/56 (87%), Positives = 50/56 (89%) Frame = +2 Query: 695 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPXQQLRSLNGEWQLKR 862 [lacZ-alpha fragment, 36 aa] P QQLRSLNGEW+L R Sbjct: 49 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMR 104 >SB_14936| Best HMM Match : Pep_M12B_propep (HMM E-Value=9.7) Length = 207 Score = 107 bits (257), Expect = 2e-23 Identities = 49/56 (87%), Positives = 50/56 (89%) Frame = +2 Query: 695 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPXQQLRSLNGEWQLKR 862 [lacZ-alpha fragment, 36 aa] P QQLRSLNGEW+L R Sbjct: 126 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMR 181 >SB_14045| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 107 bits (257), Expect = 2e-23 Identities = 49/56 (87%), Positives = 50/56 (89%) Frame = +2 Query: 695 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPXQQLRSLNGEWQLKR 862 [lacZ-alpha fragment, 36 aa] P QQLRSLNGEW+L R Sbjct: 69 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMR 124 >SB_13480| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 107 bits (257), Expect = 2e-23 Identities = 49/56 (87%), Positives = 50/56 (89%) Frame = +2 Query: 695 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPXQQLRSLNGEWQLKR 862 [lacZ-alpha fragment, 36 aa] P QQLRSLNGEW+L R Sbjct: 55 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMR 110 >SB_13236| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 107 bits (257), Expect = 2e-23 Identities = 49/56 (87%), Positives = 50/56 (89%) Frame = +2 Query: 695 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPXQQLRSLNGEWQLKR 862 [lacZ-alpha fragment, 36 aa] P QQLRSLNGEW+L R Sbjct: 54 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMR 109 >SB_12962| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 107 bits (257), Expect = 2e-23 Identities = 49/56 (87%), Positives = 50/56 (89%) Frame = +2 Query: 695 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPXQQLRSLNGEWQLKR 862 [lacZ-alpha fragment, 36 aa] P QQLRSLNGEW+L R Sbjct: 88 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMR 143 >SB_12873| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 107 bits (257), Expect = 2e-23 Identities = 49/56 (87%), Positives = 50/56 (89%) Frame = +2 Query: 695 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPXQQLRSLNGEWQLKR 862 [lacZ-alpha fragment, 36 aa] P QQLRSLNGEW+L R Sbjct: 55 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMR 110 >SB_12187| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 107 bits (257), Expect = 2e-23 Identities = 49/56 (87%), Positives = 50/56 (89%) Frame = +2 Query: 695 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPXQQLRSLNGEWQLKR 862 [lacZ-alpha fragment, 36 aa] P QQLRSLNGEW+L R Sbjct: 94 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMR 149 >SB_12019| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 107 bits (257), Expect = 2e-23 Identities = 49/56 (87%), Positives = 50/56 (89%) Frame = +2 Query: 695 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPXQQLRSLNGEWQLKR 862 [lacZ-alpha fragment, 36 aa] P QQLRSLNGEW+L R Sbjct: 65 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMR 120 >SB_11632| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 248 Score = 107 bits (257), Expect = 2e-23 Identities = 49/56 (87%), Positives = 50/56 (89%) Frame = +2 Query: 695 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPXQQLRSLNGEWQLKR 862 [lacZ-alpha fragment, 36 aa] P QQLRSLNGEW+L R Sbjct: 167 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMR 222 >SB_10031| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 160 Score = 107 bits (257), Expect = 2e-23 Identities = 49/56 (87%), Positives = 50/56 (89%) Frame = +2 Query: 695 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPXQQLRSLNGEWQLKR 862 [lacZ-alpha fragment, 36 aa] P QQLRSLNGEW+L R Sbjct: 79 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMR 134 >SB_9995| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 107 bits (257), Expect = 2e-23 Identities = 49/56 (87%), Positives = 50/56 (89%) Frame = +2 Query: 695 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPXQQLRSLNGEWQLKR 862 [lacZ-alpha fragment, 36 aa] P QQLRSLNGEW+L R Sbjct: 57 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMR 112 >SB_9450| Best HMM Match : CM_1 (HMM E-Value=3.1) Length = 186 Score = 107 bits (257), Expect = 2e-23 Identities = 49/56 (87%), Positives = 50/56 (89%) Frame = +2 Query: 695 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPXQQLRSLNGEWQLKR 862 [lacZ-alpha fragment, 36 aa] P QQLRSLNGEW+L R Sbjct: 105 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMR 160 >SB_8806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 101 Score = 107 bits (257), Expect = 2e-23 Identities = 54/87 (62%), Positives = 59/87 (67%) Frame = +2 Query: 596 IPNI*EIVLKKKKKNSRGGPVXXXXXXXXXXXXLAVVLQRRDWENPGVTQLNRLAAHPPF 775 +P I+ KK +G P+ LAVVLQRRDWENPGVTQLNRLAAHPPF Sbjct: 15 LPTKAAIIQHTKKAAFQGDPLESTCRHASLA--LAVVLQRRDWENPGVTQLNRLAAHPPF 72 Query: 776 ASWRNSEEAPHRSPXQQLRSLNGEWQL 856 ASWRNSEEA P QQLRSLNGEW+L Sbjct: 73 ASWRNSEEARTDRPSQQLRSLNGEWRL 99 >SB_8621| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 200 Score = 107 bits (257), Expect = 2e-23 Identities = 49/56 (87%), Positives = 50/56 (89%) Frame = +2 Query: 695 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPXQQLRSLNGEWQLKR 862 [lacZ-alpha fragment, 36 aa] P QQLRSLNGEW+L R Sbjct: 119 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMR 174 >SB_8530| Best HMM Match : ThiC (HMM E-Value=2.7e-07) Length = 183 Score = 107 bits (257), Expect = 2e-23 Identities = 49/56 (87%), Positives = 50/56 (89%) Frame = +2 Query: 695 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPXQQLRSLNGEWQLKR 862 [lacZ-alpha fragment, 36 aa] P QQLRSLNGEW+L R Sbjct: 102 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMR 157 >SB_8498| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 115 Score = 107 bits (257), Expect = 2e-23 Identities = 49/56 (87%), Positives = 50/56 (89%) Frame = +2 Query: 695 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPXQQLRSLNGEWQLKR 862 [lacZ-alpha fragment, 36 aa] P QQLRSLNGEW+L R Sbjct: 34 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMR 89 >SB_5521| Best HMM Match : SWIM (HMM E-Value=6.9) Length = 150 Score = 107 bits (257), Expect = 2e-23 Identities = 49/56 (87%), Positives = 50/56 (89%) Frame = +2 Query: 695 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPXQQLRSLNGEWQLKR 862 [lacZ-alpha fragment, 36 aa] P QQLRSLNGEW+L R Sbjct: 69 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMR 124 >SB_5457| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 207 Score = 107 bits (257), Expect = 2e-23 Identities = 49/56 (87%), Positives = 50/56 (89%) Frame = +2 Query: 695 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPXQQLRSLNGEWQLKR 862 [lacZ-alpha fragment, 36 aa] P QQLRSLNGEW+L R Sbjct: 126 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMR 181 >SB_3676| Best HMM Match : Cuticle_2 (HMM E-Value=3.2) Length = 322 Score = 107 bits (257), Expect = 2e-23 Identities = 49/56 (87%), Positives = 50/56 (89%) Frame = +2 Query: 695 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPXQQLRSLNGEWQLKR 862 [lacZ-alpha fragment, 36 aa] P QQLRSLNGEW+L R Sbjct: 26 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMR 81 >SB_2468| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 287 Score = 107 bits (257), Expect = 2e-23 Identities = 49/56 (87%), Positives = 50/56 (89%) Frame = +2 Query: 695 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPXQQLRSLNGEWQLKR 862 [lacZ-alpha fragment, 36 aa] P QQLRSLNGEW+L R Sbjct: 71 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMR 126 >SB_2230| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 107 bits (257), Expect = 2e-23 Identities = 49/56 (87%), Positives = 50/56 (89%) Frame = +2 Query: 695 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPXQQLRSLNGEWQLKR 862 [lacZ-alpha fragment, 36 aa] P QQLRSLNGEW+L R Sbjct: 85 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMR 140 >SB_965| Best HMM Match : IgG_binding_B (HMM E-Value=8.5) Length = 174 Score = 107 bits (257), Expect = 2e-23 Identities = 49/56 (87%), Positives = 50/56 (89%) Frame = +2 Query: 695 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPXQQLRSLNGEWQLKR 862 [lacZ-alpha fragment, 36 aa] P QQLRSLNGEW+L R Sbjct: 93 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMR 148 >SB_56058| Best HMM Match : Phasin (HMM E-Value=2.7) Length = 314 Score = 107 bits (257), Expect = 2e-23 Identities = 49/54 (90%), Positives = 49/54 (90%) Frame = -3 Query: 849 HSPFRLRNCWXGDRCGASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 688 HSPFRLRNCW G ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 261 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 314 >SB_55925| Best HMM Match : Homeobox (HMM E-Value=1e-26) Length = 1064 Score = 107 bits (257), Expect = 2e-23 Identities = 49/56 (87%), Positives = 50/56 (89%) Frame = +2 Query: 695 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPXQQLRSLNGEWQLKR 862 [lacZ-alpha fragment, 36 aa] P QQLRSLNGEW+L R Sbjct: 791 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMR 846 >SB_55779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 107 bits (257), Expect = 2e-23 Identities = 49/56 (87%), Positives = 50/56 (89%) Frame = +2 Query: 695 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPXQQLRSLNGEWQLKR 862 [lacZ-alpha fragment, 36 aa] P QQLRSLNGEW+L R Sbjct: 72 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMR 127 >SB_55121| Best HMM Match : DUF971 (HMM E-Value=8.5) Length = 174 Score = 107 bits (257), Expect = 2e-23 Identities = 49/56 (87%), Positives = 50/56 (89%) Frame = +2 Query: 695 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPXQQLRSLNGEWQLKR 862 [lacZ-alpha fragment, 36 aa] P QQLRSLNGEW+L R Sbjct: 93 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMR 148 >SB_54995| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 107 bits (257), Expect = 2e-23 Identities = 49/56 (87%), Positives = 50/56 (89%) Frame = +2 Query: 695 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPXQQLRSLNGEWQLKR 862 [lacZ-alpha fragment, 36 aa] P QQLRSLNGEW+L R Sbjct: 107 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMR 162 >SB_53532| Best HMM Match : IgG_binding_B (HMM E-Value=7.8) Length = 162 Score = 107 bits (257), Expect = 2e-23 Identities = 49/56 (87%), Positives = 50/56 (89%) Frame = +2 Query: 695 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPXQQLRSLNGEWQLKR 862 [lacZ-alpha fragment, 36 aa] P QQLRSLNGEW+L R Sbjct: 81 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMR 136 >SB_52523| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 498 Score = 107 bits (257), Expect = 2e-23 Identities = 49/54 (90%), Positives = 49/54 (90%) Frame = -3 Query: 849 HSPFRLRNCWXGDRCGASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 688 HSPFRLRNCW G ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 445 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 498 >SB_52081| Best HMM Match : DUF1634 (HMM E-Value=0.55) Length = 189 Score = 107 bits (257), Expect = 2e-23 Identities = 49/56 (87%), Positives = 50/56 (89%) Frame = +2 Query: 695 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPXQQLRSLNGEWQLKR 862 [lacZ-alpha fragment, 36 aa] P QQLRSLNGEW+L R Sbjct: 108 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMR 163 >SB_51949| Best HMM Match : Toxin_14 (HMM E-Value=0.051) Length = 387 Score = 107 bits (257), Expect = 2e-23 Identities = 49/56 (87%), Positives = 50/56 (89%) Frame = +2 Query: 695 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPXQQLRSLNGEWQLKR 862 [lacZ-alpha fragment, 36 aa] P QQLRSLNGEW+L R Sbjct: 306 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMR 361 >SB_49112| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 107 bits (257), Expect = 2e-23 Identities = 49/56 (87%), Positives = 50/56 (89%) Frame = +2 Query: 695 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPXQQLRSLNGEWQLKR 862 [lacZ-alpha fragment, 36 aa] P QQLRSLNGEW+L R Sbjct: 52 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMR 107 >SB_48731| Best HMM Match : zf-C3HC4 (HMM E-Value=6.5e-08) Length = 688 Score = 107 bits (257), Expect = 2e-23 Identities = 49/56 (87%), Positives = 50/56 (89%) Frame = +2 Query: 695 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPXQQLRSLNGEWQLKR 862 [lacZ-alpha fragment, 36 aa] P QQLRSLNGEW+L R Sbjct: 15 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMR 70 >SB_48358| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 96 Score = 107 bits (257), Expect = 2e-23 Identities = 49/56 (87%), Positives = 50/56 (89%) Frame = +2 Query: 695 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPXQQLRSLNGEWQLKR 862 [lacZ-alpha fragment, 36 aa] P QQLRSLNGEW+L R Sbjct: 26 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMR 81 >SB_46830| Best HMM Match : Succ_DH_flav_C (HMM E-Value=3.2e-37) Length = 333 Score = 107 bits (257), Expect = 2e-23 Identities = 49/54 (90%), Positives = 49/54 (90%) Frame = -3 Query: 849 HSPFRLRNCWXGDRCGASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 688 HSPFRLRNCW G ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 280 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 333 >SB_46185| Best HMM Match : Flt3_lig (HMM E-Value=3.3) Length = 292 Score = 107 bits (257), Expect = 2e-23 Identities = 49/56 (87%), Positives = 50/56 (89%) Frame = +2 Query: 695 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPXQQLRSLNGEWQLKR 862 [lacZ-alpha fragment, 36 aa] P QQLRSLNGEW+L R Sbjct: 53 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMR 108 >SB_45065| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 107 bits (257), Expect = 2e-23 Identities = 49/56 (87%), Positives = 50/56 (89%) Frame = +2 Query: 695 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPXQQLRSLNGEWQLKR 862 [lacZ-alpha fragment, 36 aa] P QQLRSLNGEW+L R Sbjct: 56 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMR 111 >SB_44400| Best HMM Match : AT_hook (HMM E-Value=3.3) Length = 328 Score = 107 bits (257), Expect = 2e-23 Identities = 49/56 (87%), Positives = 50/56 (89%) Frame = +2 Query: 695 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPXQQLRSLNGEWQLKR 862 [lacZ-alpha fragment, 36 aa] P QQLRSLNGEW+L R Sbjct: 247 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMR 302 >SB_43660| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 107 bits (257), Expect = 2e-23 Identities = 49/56 (87%), Positives = 50/56 (89%) Frame = +2 Query: 695 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPXQQLRSLNGEWQLKR 862 [lacZ-alpha fragment, 36 aa] P QQLRSLNGEW+L R Sbjct: 81 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMR 136 >SB_43339| Best HMM Match : SAC3_GANP (HMM E-Value=1.8e-09) Length = 657 Score = 107 bits (257), Expect = 2e-23 Identities = 49/56 (87%), Positives = 50/56 (89%) Frame = +2 Query: 695 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPXQQLRSLNGEWQLKR 862 [lacZ-alpha fragment, 36 aa] P QQLRSLNGEW+L R Sbjct: 34 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMR 89 >SB_42664| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 107 bits (257), Expect = 2e-23 Identities = 49/56 (87%), Positives = 50/56 (89%) Frame = +2 Query: 695 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPXQQLRSLNGEWQLKR 862 [lacZ-alpha fragment, 36 aa] P QQLRSLNGEW+L R Sbjct: 48 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMR 103 >SB_42128| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 107 bits (257), Expect = 2e-23 Identities = 49/54 (90%), Positives = 49/54 (90%) Frame = -3 Query: 849 HSPFRLRNCWXGDRCGASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 688 HSPFRLRNCW G ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 130 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 183 >SB_41564| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 107 bits (257), Expect = 2e-23 Identities = 49/56 (87%), Positives = 50/56 (89%) Frame = +2 Query: 695 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPXQQLRSLNGEWQLKR 862 [lacZ-alpha fragment, 36 aa] P QQLRSLNGEW+L R Sbjct: 24 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMR 79 >SB_40139| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 107 bits (257), Expect = 2e-23 Identities = 49/54 (90%), Positives = 49/54 (90%) Frame = -3 Query: 849 HSPFRLRNCWXGDRCGASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 688 HSPFRLRNCW G ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 4 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 57 >SB_36598| Best HMM Match : E-MAP-115 (HMM E-Value=0.092) Length = 783 Score = 107 bits (257), Expect = 2e-23 Identities = 49/56 (87%), Positives = 50/56 (89%) Frame = +2 Query: 695 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPXQQLRSLNGEWQLKR 862 [lacZ-alpha fragment, 36 aa] P QQLRSLNGEW+L R Sbjct: 719 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMR 774 >SB_35835| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 107 bits (257), Expect = 2e-23 Identities = 49/56 (87%), Positives = 50/56 (89%) Frame = +2 Query: 695 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPXQQLRSLNGEWQLKR 862 [lacZ-alpha fragment, 36 aa] P QQLRSLNGEW+L R Sbjct: 39 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMR 94 >SB_31775| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 551 Score = 107 bits (257), Expect = 2e-23 Identities = 49/56 (87%), Positives = 50/56 (89%) Frame = +2 Query: 695 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPXQQLRSLNGEWQLKR 862 [lacZ-alpha fragment, 36 aa] P QQLRSLNGEW+L R Sbjct: 187 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMR 242 >SB_31293| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 107 bits (257), Expect = 2e-23 Identities = 49/54 (90%), Positives = 49/54 (90%) Frame = -3 Query: 849 HSPFRLRNCWXGDRCGASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 688 HSPFRLRNCW G ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 4 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 57 >SB_30891| Best HMM Match : LIM (HMM E-Value=4.40008e-43) Length = 511 Score = 107 bits (257), Expect = 2e-23 Identities = 49/56 (87%), Positives = 50/56 (89%) Frame = +2 Query: 695 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPXQQLRSLNGEWQLKR 862 [lacZ-alpha fragment, 36 aa] P QQLRSLNGEW+L R Sbjct: 115 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMR 170 >SB_30664| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 107 bits (257), Expect = 2e-23 Identities = 49/56 (87%), Positives = 50/56 (89%) Frame = +2 Query: 695 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPXQQLRSLNGEWQLKR 862 [lacZ-alpha fragment, 36 aa] P QQLRSLNGEW+L R Sbjct: 30 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMR 85 >SB_28552| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 107 bits (257), Expect = 2e-23 Identities = 49/56 (87%), Positives = 50/56 (89%) Frame = +2 Query: 695 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPXQQLRSLNGEWQLKR 862 [lacZ-alpha fragment, 36 aa] P QQLRSLNGEW+L R Sbjct: 20 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMR 75 >SB_27244| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 107 bits (257), Expect = 2e-23 Identities = 49/56 (87%), Positives = 50/56 (89%) Frame = +2 Query: 695 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPXQQLRSLNGEWQLKR 862 [lacZ-alpha fragment, 36 aa] P QQLRSLNGEW+L R Sbjct: 85 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMR 140 >SB_26386| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 107 bits (257), Expect = 2e-23 Identities = 49/56 (87%), Positives = 50/56 (89%) Frame = +2 Query: 695 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPXQQLRSLNGEWQLKR 862 [lacZ-alpha fragment, 36 aa] P QQLRSLNGEW+L R Sbjct: 32 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMR 87 >SB_25785| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 190 Score = 107 bits (257), Expect = 2e-23 Identities = 49/56 (87%), Positives = 50/56 (89%) Frame = +2 Query: 695 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPXQQLRSLNGEWQLKR 862 [lacZ-alpha fragment, 36 aa] P QQLRSLNGEW+L R Sbjct: 109 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMR 164 >SB_25673| Best HMM Match : MFS_1 (HMM E-Value=0.18) Length = 634 Score = 107 bits (257), Expect = 2e-23 Identities = 49/54 (90%), Positives = 49/54 (90%) Frame = -3 Query: 849 HSPFRLRNCWXGDRCGASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 688 HSPFRLRNCW G ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 581 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 634 >SB_20758| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 107 bits (257), Expect = 2e-23 Identities = 49/56 (87%), Positives = 50/56 (89%) Frame = +2 Query: 695 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPXQQLRSLNGEWQLKR 862 [lacZ-alpha fragment, 36 aa] P QQLRSLNGEW+L R Sbjct: 37 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMR 92 >SB_20620| Best HMM Match : zf-HIT (HMM E-Value=8.5e-10) Length = 567 Score = 107 bits (257), Expect = 2e-23 Identities = 49/56 (87%), Positives = 50/56 (89%) Frame = +2 Query: 695 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPXQQLRSLNGEWQLKR 862 [lacZ-alpha fragment, 36 aa] P QQLRSLNGEW+L R Sbjct: 198 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMR 253 >SB_19831| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 107 bits (257), Expect = 2e-23 Identities = 49/56 (87%), Positives = 50/56 (89%) Frame = +2 Query: 695 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPXQQLRSLNGEWQLKR 862 [lacZ-alpha fragment, 36 aa] P QQLRSLNGEW+L R Sbjct: 60 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMR 115 >SB_19310| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 107 bits (257), Expect = 2e-23 Identities = 49/56 (87%), Positives = 50/56 (89%) Frame = +2 Query: 695 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPXQQLRSLNGEWQLKR 862 [lacZ-alpha fragment, 36 aa] P QQLRSLNGEW+L R Sbjct: 21 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMR 76 >SB_14754| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 107 bits (257), Expect = 2e-23 Identities = 49/56 (87%), Positives = 50/56 (89%) Frame = +2 Query: 695 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPXQQLRSLNGEWQLKR 862 [lacZ-alpha fragment, 36 aa] P QQLRSLNGEW+L R Sbjct: 41 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMR 96 >SB_12047| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 107 bits (257), Expect = 2e-23 Identities = 49/56 (87%), Positives = 50/56 (89%) Frame = +2 Query: 695 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPXQQLRSLNGEWQLKR 862 [lacZ-alpha fragment, 36 aa] P QQLRSLNGEW+L R Sbjct: 67 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMR 122 >SB_11928| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 107 bits (257), Expect = 2e-23 Identities = 49/56 (87%), Positives = 50/56 (89%) Frame = +2 Query: 695 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPXQQLRSLNGEWQLKR 862 [lacZ-alpha fragment, 36 aa] P QQLRSLNGEW+L R Sbjct: 44 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMR 99 >SB_11382| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 107 bits (257), Expect = 2e-23 Identities = 49/56 (87%), Positives = 50/56 (89%) Frame = +2 Query: 695 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPXQQLRSLNGEWQLKR 862 [lacZ-alpha fragment, 36 aa] P QQLRSLNGEW+L R Sbjct: 62 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMR 117 >SB_9250| Best HMM Match : BAG (HMM E-Value=6.2) Length = 232 Score = 107 bits (257), Expect = 2e-23 Identities = 49/54 (90%), Positives = 49/54 (90%) Frame = -3 Query: 849 HSPFRLRNCWXGDRCGASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 688 HSPFRLRNCW G ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL Sbjct: 179 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 232 >SB_8032| Best HMM Match : IBB (HMM E-Value=0.46) Length = 191 Score = 107 bits (257), Expect = 2e-23 Identities = 49/56 (87%), Positives = 50/56 (89%) Frame = +2 Query: 695 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPXQQLRSLNGEWQLKR 862 [lacZ-alpha fragment, 36 aa] P QQLRSLNGEW+L R Sbjct: 121 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMR 176 >SB_7769| Best HMM Match : Histone (HMM E-Value=0.2) Length = 150 Score = 107 bits (257), Expect = 2e-23 Identities = 49/56 (87%), Positives = 50/56 (89%) Frame = +2 Query: 695 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPXQQLRSLNGEWQLKR 862 [lacZ-alpha fragment, 36 aa] P QQLRSLNGEW+L R Sbjct: 69 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMR 124 >SB_7742| Best HMM Match : HEAT (HMM E-Value=9e-23) Length = 940 Score = 107 bits (257), Expect = 2e-23 Identities = 49/56 (87%), Positives = 50/56 (89%) Frame = +2 Query: 695 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPXQQLRSLNGEWQLKR 862 [lacZ-alpha fragment, 36 aa] P QQLRSLNGEW+L R Sbjct: 364 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMR 419 >SB_5394| Best HMM Match : PEGSRP (HMM E-Value=1.5) Length = 144 Score = 107 bits (257), Expect = 2e-23 Identities = 49/56 (87%), Positives = 50/56 (89%) Frame = +2 Query: 695 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPXQQLRSLNGEWQLKR 862 [lacZ-alpha fragment, 36 aa] P QQLRSLNGEW+L R Sbjct: 54 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMR 109 >SB_372| Best HMM Match : CBM_2 (HMM E-Value=0.00043) Length = 630 Score = 107 bits (257), Expect = 2e-23 Identities = 49/56 (87%), Positives = 50/56 (89%) Frame = +2 Query: 695 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPXQQLRSLNGEWQLKR 862 [lacZ-alpha fragment, 36 aa] P QQLRSLNGEW+L R Sbjct: 437 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMR 492 >SB_29521| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 106 bits (255), Expect = 4e-23 Identities = 50/59 (84%), Positives = 50/59 (84%) Frame = -3 Query: 849 HSPFRLRNCWXGDRCGASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL*YDSL 673 HSPFRLRNCW G ASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASE D L Sbjct: 4 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEFPGDPL 62 Score = 103 bits (248), Expect = 3e-22 Identities = 47/52 (90%), Positives = 47/52 (90%) Frame = +2 Query: 695 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPXQQLRSLNGEW 850 [lacZ-alpha fragment, 36 aa] P QQLRSLNGEW Sbjct: 85 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 136 >SB_6070| Best HMM Match : PEGSRP (HMM E-Value=3.8) Length = 82 Score = 106 bits (255), Expect = 4e-23 Identities = 51/74 (68%), Positives = 54/74 (72%) Frame = +2 Query: 635 KNSRGGPVXXXXXXXXXXXXLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRS 814 + +GG V [lacZ-alpha fragment, 36 aa] Sbjct: 8 RREKGGQVSESTCRHASLA-LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDR 66 Query: 815 PXQQLRSLNGEWQL 856 P QQLRSLNGEW+L Sbjct: 67 PSQQLRSLNGEWRL 80 >SB_43138| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.3e-14) Length = 1709 Score = 106 bits (254), Expect = 5e-23 Identities = 51/80 (63%), Positives = 54/80 (67%) Frame = +2 Query: 611 EIVLKKKKKNSRGGPVXXXXXXXXXXXXLAVVLQRRDWENPGVTQLNRLAAHPPFASWRN 790 E K+++ N P LAVVLQRRDWENPGVTQLNRLAAHPPFASWRN Sbjct: 1445 EASTKEERVNDHRIPAARGIHYESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRN 1504 Query: 791 SEEAPHRSPXQQLRSLNGEW 850 SEEA P QQLRSLNGEW Sbjct: 1505 SEEARTDRPSQQLRSLNGEW 1524 >SB_8442| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 106 bits (254), Expect = 5e-23 Identities = 50/77 (64%), Positives = 54/77 (70%) Frame = +2 Query: 620 LKKKKKNSRGGPVXXXXXXXXXXXXLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 799 +KK+++ R LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE Sbjct: 23 IKKQRRYERLAATSQLSLCESYYNSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 82 Query: 800 APHRSPXQQLRSLNGEW 850 A P QQLRSLNGEW Sbjct: 83 ARTDRPSQQLRSLNGEW 99 >SB_57829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 105 bits (253), Expect = 7e-23 Identities = 48/54 (88%), Positives = 49/54 (90%) Frame = +2 Query: 695 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPXQQLRSLNGEWQL 856 [lacZ-alpha fragment, 36 aa] P QQLRSLNGEW+L Sbjct: 16 [lacZ-alpha fragment, 54 aa] 69 >SB_57692| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 84 Score = 105 bits (253), Expect = 7e-23 Identities = 48/54 (88%), Positives = 49/54 (90%) Frame = +2 Query: 695 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPXQQLRSLNGEWQL 856 [lacZ-alpha fragment, 36 aa] P QQLRSLNGEW+L Sbjct: 29 [lacZ-alpha fragment, 54 aa] 82 >SB_57259| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 105 bits (253), Expect = 7e-23 Identities = 48/54 (88%), Positives = 49/54 (90%) Frame = +2 Query: 695 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPXQQLRSLNGEWQL 856 [lacZ-alpha fragment, 36 aa] P QQLRSLNGEW+L Sbjct: 18 [lacZ-alpha fragment, 54 aa] 71 >SB_56880| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 105 bits (253), Expect = 7e-23 Identities = 48/54 (88%), Positives = 49/54 (90%) Frame = +2 Query: 695 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPXQQLRSLNGEWQL 856 [lacZ-alpha fragment, 36 aa] P QQLRSLNGEW+L Sbjct: 16 [lacZ-alpha fragment, 54 aa] 69 >SB_56642| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 105 bits (253), Expect = 7e-23 Identities = 48/54 (88%), Positives = 49/54 (90%) Frame = +2 Query: 695 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPXQQLRSLNGEWQL 856 [lacZ-alpha fragment, 36 aa] P QQLRSLNGEW+L Sbjct: 16 [lacZ-alpha fragment, 54 aa] 69 >SB_55703| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 105 bits (253), Expect = 7e-23 Identities = 48/54 (88%), Positives = 49/54 (90%) Frame = +2 Query: 695 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPXQQLRSLNGEWQL 856 [lacZ-alpha fragment, 36 aa] P QQLRSLNGEW+L Sbjct: 20 [lacZ-alpha fragment, 54 aa] 73 >SB_55192| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 74 Score = 105 bits (253), Expect = 7e-23 Identities = 48/54 (88%), Positives = 49/54 (90%) Frame = +2 Query: 695 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPXQQLRSLNGEWQL 856 [lacZ-alpha fragment, 36 aa] P QQLRSLNGEW+L Sbjct: 19 [lacZ-alpha fragment, 54 aa] 72 >SB_53366| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 105 bits (253), Expect = 7e-23 Identities = 48/54 (88%), Positives = 49/54 (90%) Frame = +2 Query: 695 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPXQQLRSLNGEWQL 856 [lacZ-alpha fragment, 36 aa] P QQLRSLNGEW+L Sbjct: 37 [lacZ-alpha fragment, 54 aa] 90 >SB_52265| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 105 bits (253), Expect = 7e-23 Identities = 48/54 (88%), Positives = 49/54 (90%) Frame = +2 Query: 695 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPXQQLRSLNGEWQL 856 [lacZ-alpha fragment, 36 aa] P QQLRSLNGEW+L Sbjct: 132 [lacZ-alpha fragment, 54 aa] 185 >SB_51529| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 105 bits (253), Expect = 7e-23 Identities = 48/54 (88%), Positives = 49/54 (90%) Frame = +2 Query: 695 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPXQQLRSLNGEWQL 856 [lacZ-alpha fragment, 36 aa] P QQLRSLNGEW+L Sbjct: 21 [lacZ-alpha fragment, 54 aa] 74 >SB_50473| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 105 bits (253), Expect = 7e-23 Identities = 48/54 (88%), Positives = 49/54 (90%) Frame = +2 Query: 695 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPXQQLRSLNGEWQL 856 [lacZ-alpha fragment, 36 aa] P QQLRSLNGEW+L Sbjct: 16 [lacZ-alpha fragment, 54 aa] 69 >SB_49542| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 88 Score = 105 bits (253), Expect = 7e-23 Identities = 48/54 (88%), Positives = 49/54 (90%) Frame = +2 Query: 695 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPXQQLRSLNGEWQL 856 [lacZ-alpha fragment, 36 aa] P QQLRSLNGEW+L Sbjct: 33 [lacZ-alpha fragment, 54 aa] 86 >SB_45642| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 105 bits (253), Expect = 7e-23 Identities = 48/54 (88%), Positives = 49/54 (90%) Frame = +2 Query: 695 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPXQQLRSLNGEWQL 856 [lacZ-alpha fragment, 36 aa] P QQLRSLNGEW+L Sbjct: 77 [lacZ-alpha fragment, 54 aa] 130 >SB_45291| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 86 Score = 105 bits (253), Expect = 7e-23 Identities = 48/54 (88%), Positives = 49/54 (90%) Frame = +2 Query: 695 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPXQQLRSLNGEWQL 856 [lacZ-alpha fragment, 36 aa] P QQLRSLNGEW+L Sbjct: 31 [lacZ-alpha fragment, 54 aa] 84 >SB_44894| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 105 bits (253), Expect = 7e-23 Identities = 48/54 (88%), Positives = 49/54 (90%) Frame = +2 Query: 695 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPXQQLRSLNGEWQL 856 [lacZ-alpha fragment, 36 aa] P QQLRSLNGEW+L Sbjct: 16 [lacZ-alpha fragment, 54 aa] 69 >SB_44606| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 89 Score = 105 bits (253), Expect = 7e-23 Identities = 48/54 (88%), Positives = 49/54 (90%) Frame = +2 Query: 695 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPXQQLRSLNGEWQL 856 [lacZ-alpha fragment, 36 aa] P QQLRSLNGEW+L Sbjct: 34 [lacZ-alpha fragment, 54 aa] 87 >SB_44604| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 105 bits (253), Expect = 7e-23 Identities = 48/54 (88%), Positives = 49/54 (90%) Frame = +2 Query: 695 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPXQQLRSLNGEWQL 856 [lacZ-alpha fragment, 36 aa] P QQLRSLNGEW+L Sbjct: 36 [lacZ-alpha fragment, 54 aa] 89 >SB_43569| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 105 bits (253), Expect = 7e-23 Identities = 48/54 (88%), Positives = 49/54 (90%) Frame = +2 Query: 695 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPXQQLRSLNGEWQL 856 [lacZ-alpha fragment, 36 aa] P QQLRSLNGEW+L Sbjct: 40 [lacZ-alpha fragment, 54 aa] 93 >SB_42725| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 105 bits (253), Expect = 7e-23 Identities = 48/54 (88%), Positives = 49/54 (90%) Frame = +2 Query: 695 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPXQQLRSLNGEWQL 856 [lacZ-alpha fragment, 36 aa] P QQLRSLNGEW+L Sbjct: 21 [lacZ-alpha fragment, 54 aa] 74 >SB_41806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 105 bits (253), Expect = 7e-23 Identities = 48/54 (88%), Positives = 49/54 (90%) Frame = +2 Query: 695 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPXQQLRSLNGEWQL 856 [lacZ-alpha fragment, 36 aa] P QQLRSLNGEW+L Sbjct: 16 [lacZ-alpha fragment, 54 aa] 69 >SB_39373| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 105 bits (253), Expect = 7e-23 Identities = 48/54 (88%), Positives = 49/54 (90%) Frame = +2 Query: 695 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPXQQLRSLNGEWQL 856 [lacZ-alpha fragment, 36 aa] P QQLRSLNGEW+L Sbjct: 17 [lacZ-alpha fragment, 54 aa] 70 >SB_38916| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 86 Score = 105 bits (253), Expect = 7e-23 Identities = 48/54 (88%), Positives = 49/54 (90%) Frame = +2 Query: 695 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPXQQLRSLNGEWQL 856 [lacZ-alpha fragment, 36 aa] P QQLRSLNGEW+L Sbjct: 31 [lacZ-alpha fragment, 54 aa] 84 >SB_37412| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 74 Score = 105 bits (253), Expect = 7e-23 Identities = 48/54 (88%), Positives = 49/54 (90%) Frame = +2 Query: 695 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPXQQLRSLNGEWQL 856 [lacZ-alpha fragment, 36 aa] P QQLRSLNGEW+L Sbjct: 19 [lacZ-alpha fragment, 54 aa] 72 >SB_34683| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 102 Score = 105 bits (253), Expect = 7e-23 Identities = 48/54 (88%), Positives = 49/54 (90%) Frame = +2 Query: 695 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPXQQLRSLNGEWQL 856 [lacZ-alpha fragment, 36 aa] P QQLRSLNGEW+L Sbjct: 47 [lacZ-alpha fragment, 54 aa] 100 >SB_34501| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 87 Score = 105 bits (253), Expect = 7e-23 Identities = 48/54 (88%), Positives = 49/54 (90%) Frame = +2 Query: 695 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPXQQLRSLNGEWQL 856 [lacZ-alpha fragment, 36 aa] P QQLRSLNGEW+L Sbjct: 32 [lacZ-alpha fragment, 54 aa] 85 >SB_33403| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 105 bits (253), Expect = 7e-23 Identities = 48/54 (88%), Positives = 49/54 (90%) Frame = +2 Query: 695 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPXQQLRSLNGEWQL 856 [lacZ-alpha fragment, 36 aa] P QQLRSLNGEW+L Sbjct: 58 [lacZ-alpha fragment, 54 aa] 111 >SB_32674| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 105 bits (253), Expect = 7e-23 Identities = 48/54 (88%), Positives = 49/54 (90%) Frame = +2 Query: 695 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPXQQLRSLNGEWQL 856 [lacZ-alpha fragment, 36 aa] P QQLRSLNGEW+L Sbjct: 17 [lacZ-alpha fragment, 54 aa] 70 >SB_32508| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 115 Score = 105 bits (253), Expect = 7e-23 Identities = 48/54 (88%), Positives = 49/54 (90%) Frame = +2 Query: 695 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPXQQLRSLNGEWQL 856 [lacZ-alpha fragment, 36 aa] P QQLRSLNGEW+L Sbjct: 60 [lacZ-alpha fragment, 54 aa] 113 Score = 55.2 bits (127), Expect = 1e-07 Identities = 24/32 (75%), Positives = 27/32 (84%) Frame = +2 Query: 752 RLAAHPPFASWRNSEEAPHRSPXQQLRSLNGE 847 +++AHPPFASWRNSEEA P QQLRSLNGE Sbjct: 14 QVSAHPPFASWRNSEEARTDRPSQQLRSLNGE 45 >SB_30786| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 105 bits (253), Expect = 7e-23 Identities = 48/54 (88%), Positives = 49/54 (90%) Frame = +2 Query: 695 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPXQQLRSLNGEWQL 856 [lacZ-alpha fragment, 36 aa] P QQLRSLNGEW+L Sbjct: 20 [lacZ-alpha fragment, 54 aa] 73 >SB_29084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 116 Score = 105 bits (253), Expect = 7e-23 Identities = 48/54 (88%), Positives = 49/54 (90%) Frame = +2 Query: 695 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPXQQLRSLNGEWQL 856 [lacZ-alpha fragment, 36 aa] P QQLRSLNGEW+L Sbjct: 61 [lacZ-alpha fragment, 54 aa] 114 >SB_27619| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 105 bits (253), Expect = 7e-23 Identities = 48/54 (88%), Positives = 49/54 (90%) Frame = +2 Query: 695 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPXQQLRSLNGEWQL 856 [lacZ-alpha fragment, 36 aa] P QQLRSLNGEW+L Sbjct: 17 [lacZ-alpha fragment, 54 aa] 70 >SB_24181| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 105 bits (253), Expect = 7e-23 Identities = 48/54 (88%), Positives = 49/54 (90%) Frame = +2 Query: 695 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPXQQLRSLNGEWQL 856 [lacZ-alpha fragment, 36 aa] P QQLRSLNGEW+L Sbjct: 20 [lacZ-alpha fragment, 54 aa] 73 >SB_22658| Best HMM Match : Protamine_3 (HMM E-Value=9.6) Length = 128 Score = 105 bits (253), Expect = 7e-23 Identities = 48/54 (88%), Positives = 49/54 (90%) Frame = +2 Query: 695 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPXQQLRSLNGEWQL 856 [lacZ-alpha fragment, 36 aa] P QQLRSLNGEW+L Sbjct: 73 [lacZ-alpha fragment, 54 aa] 126 >SB_22468| Best HMM Match : CUT (HMM E-Value=6.8) Length = 197 Score = 105 bits (253), Expect = 7e-23 Identities = 48/54 (88%), Positives = 49/54 (90%) Frame = +2 Query: 695 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPXQQLRSLNGEWQL 856 [lacZ-alpha fragment, 36 aa] P QQLRSLNGEW+L Sbjct: 142 [lacZ-alpha fragment, 54 aa] 195 >SB_20839| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 105 bits (253), Expect = 7e-23 Identities = 48/54 (88%), Positives = 49/54 (90%) Frame = +2 Query: 695 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPXQQLRSLNGEWQL 856 [lacZ-alpha fragment, 36 aa] P QQLRSLNGEW+L Sbjct: 20 [lacZ-alpha fragment, 54 aa] 73 >SB_20747| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 105 bits (253), Expect = 7e-23 Identities = 48/54 (88%), Positives = 49/54 (90%) Frame = +2 Query: 695 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPXQQLRSLNGEWQL 856 [lacZ-alpha fragment, 36 aa] P QQLRSLNGEW+L Sbjct: 16 [lacZ-alpha fragment, 54 aa] 69 >SB_15150| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 96 Score = 105 bits (253), Expect = 7e-23 Identities = 48/54 (88%), Positives = 49/54 (90%) Frame = +2 Query: 695 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPXQQLRSLNGEWQL 856 [lacZ-alpha fragment, 36 aa] P QQLRSLNGEW+L Sbjct: 41 [lacZ-alpha fragment, 54 aa] 94 >SB_15134| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 77 Score = 105 bits (253), Expect = 7e-23 Identities = 48/54 (88%), Positives = 49/54 (90%) Frame = +2 Query: 695 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPXQQLRSLNGEWQL 856 [lacZ-alpha fragment, 36 aa] P QQLRSLNGEW+L Sbjct: 22 [lacZ-alpha fragment, 54 aa] 75 >SB_15127| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 105 bits (253), Expect = 7e-23 Identities = 48/54 (88%), Positives = 49/54 (90%) Frame = +2 Query: 695 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPXQQLRSLNGEWQL 856 [lacZ-alpha fragment, 36 aa] P QQLRSLNGEW+L Sbjct: 20 [lacZ-alpha fragment, 54 aa] 73 >SB_14862| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 105 bits (253), Expect = 7e-23 Identities = 48/54 (88%), Positives = 49/54 (90%) Frame = +2 Query: 695 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPXQQLRSLNGEWQL 856 [lacZ-alpha fragment, 36 aa] P QQLRSLNGEW+L Sbjct: 43 [lacZ-alpha fragment, 54 aa] 96 >SB_13372| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 105 bits (253), Expect = 7e-23 Identities = 48/54 (88%), Positives = 49/54 (90%) Frame = +2 Query: 695 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPXQQLRSLNGEWQL 856 [lacZ-alpha fragment, 36 aa] P QQLRSLNGEW+L Sbjct: 18 [lacZ-alpha fragment, 54 aa] 71 >SB_12726| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 105 bits (253), Expect = 7e-23 Identities = 48/54 (88%), Positives = 49/54 (90%) Frame = +2 Query: 695 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPXQQLRSLNGEWQL 856 [lacZ-alpha fragment, 36 aa] P QQLRSLNGEW+L Sbjct: 58 [lacZ-alpha fragment, 54 aa] 111 >SB_12236| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 105 bits (253), Expect = 7e-23 Identities = 48/54 (88%), Positives = 49/54 (90%) Frame = +2 Query: 695 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPXQQLRSLNGEWQL 856 [lacZ-alpha fragment, 36 aa] P QQLRSLNGEW+L Sbjct: 20 [lacZ-alpha fragment, 54 aa] 73 >SB_11249| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 117 Score = 105 bits (253), Expect = 7e-23 Identities = 48/54 (88%), Positives = 49/54 (90%) Frame = +2 Query: 695 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPXQQLRSLNGEWQL 856 [lacZ-alpha fragment, 36 aa] P QQLRSLNGEW+L Sbjct: 62 [lacZ-alpha fragment, 54 aa] 115 >SB_10911| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 97 Score = 105 bits (253), Expect = 7e-23 Identities = 48/54 (88%), Positives = 49/54 (90%) Frame = +2 Query: 695 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPXQQLRSLNGEWQL 856 [lacZ-alpha fragment, 36 aa] P QQLRSLNGEW+L Sbjct: 42 [lacZ-alpha fragment, 54 aa] 95 >SB_10687| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 105 bits (253), Expect = 7e-23 Identities = 48/54 (88%), Positives = 49/54 (90%) Frame = +2 Query: 695 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPXQQLRSLNGEWQL 856 [lacZ-alpha fragment, 36 aa] P QQLRSLNGEW+L Sbjct: 17 [lacZ-alpha fragment, 54 aa] 70 >SB_10456| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 88 Score = 105 bits (253), Expect = 7e-23 Identities = 48/54 (88%), Positives = 49/54 (90%) Frame = +2 Query: 695 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPXQQLRSLNGEWQL 856 [lacZ-alpha fragment, 36 aa] P QQLRSLNGEW+L Sbjct: 33 [lacZ-alpha fragment, 54 aa] 86 >SB_9697| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 89 Score = 105 bits (253), Expect = 7e-23 Identities = 48/54 (88%), Positives = 49/54 (90%) Frame = +2 Query: 695 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPXQQLRSLNGEWQL 856 [lacZ-alpha fragment, 36 aa] P QQLRSLNGEW+L Sbjct: 34 [lacZ-alpha fragment, 54 aa] 87 >SB_7973| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 81 Score = 105 bits (253), Expect = 7e-23 Identities = 48/54 (88%), Positives = 49/54 (90%) Frame = +2 Query: 695 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPXQQLRSLNGEWQL 856 [lacZ-alpha fragment, 36 aa] P QQLRSLNGEW+L Sbjct: 26 [lacZ-alpha fragment, 54 aa] 79 >SB_7142| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 105 bits (253), Expect = 7e-23 Identities = 48/54 (88%), Positives = 49/54 (90%) Frame = +2 Query: 695 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPXQQLRSLNGEWQL 856 [lacZ-alpha fragment, 36 aa] P QQLRSLNGEW+L Sbjct: 55 [lacZ-alpha fragment, 54 aa] 108 >SB_6464| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 105 bits (253), Expect = 7e-23 Identities = 48/54 (88%), Positives = 49/54 (90%) Frame = +2 Query: 695 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPXQQLRSLNGEWQL 856 [lacZ-alpha fragment, 36 aa] P QQLRSLNGEW+L Sbjct: 56 [lacZ-alpha fragment, 54 aa] 109 >SB_6117| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 211 Score = 105 bits (253), Expect = 7e-23 Identities = 48/54 (88%), Positives = 49/54 (90%) Frame = +2 Query: 695 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPXQQLRSLNGEWQL 856 [lacZ-alpha fragment, 36 aa] P QQLRSLNGEW+L Sbjct: 156 [lacZ-alpha fragment, 54 aa] 209 >SB_4705| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 105 bits (253), Expect = 7e-23 Identities = 48/54 (88%), Positives = 49/54 (90%) Frame = +2 Query: 695 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPXQQLRSLNGEWQL 856 [lacZ-alpha fragment, 36 aa] P QQLRSLNGEW+L Sbjct: 58 [lacZ-alpha fragment, 54 aa] 111 >SB_4191| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 105 bits (253), Expect = 7e-23 Identities = 48/54 (88%), Positives = 49/54 (90%) Frame = +2 Query: 695 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPXQQLRSLNGEWQL 856 [lacZ-alpha fragment, 36 aa] P QQLRSLNGEW+L Sbjct: 89 [lacZ-alpha fragment, 54 aa] 142 >SB_3728| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 105 bits (253), Expect = 7e-23 Identities = 48/54 (88%), Positives = 49/54 (90%) Frame = +2 Query: 695 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPXQQLRSLNGEWQL 856 [lacZ-alpha fragment, 36 aa] P QQLRSLNGEW+L Sbjct: 18 [lacZ-alpha fragment, 54 aa] 71 >SB_1204| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 105 bits (253), Expect = 7e-23 Identities = 48/54 (88%), Positives = 49/54 (90%) Frame = +2 Query: 695 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPXQQLRSLNGEWQL 856 [lacZ-alpha fragment, 36 aa] P QQLRSLNGEW+L Sbjct: 44 [lacZ-alpha fragment, 54 aa] 97 >SB_58797| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 200 Score = 105 bits (253), Expect = 7e-23 Identities = 48/54 (88%), Positives = 49/54 (90%) Frame = +2 Query: 695 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPXQQLRSLNGEWQL 856 [lacZ-alpha fragment, 36 aa] P QQLRSLNGEW+L Sbjct: 145 [lacZ-alpha fragment, 54 aa] 198 >SB_54425| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 105 bits (253), Expect = 7e-23 Identities = 48/54 (88%), Positives = 49/54 (90%) Frame = +2 Query: 695 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPXQQLRSLNGEWQL 856 [lacZ-alpha fragment, 36 aa] P QQLRSLNGEW+L Sbjct: 16 [lacZ-alpha fragment, 54 aa] 69 >SB_51954| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 105 bits (253), Expect = 7e-23 Identities = 48/54 (88%), Positives = 49/54 (90%) Frame = +2 Query: 695 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPXQQLRSLNGEWQL 856 [lacZ-alpha fragment, 36 aa] P QQLRSLNGEW+L Sbjct: 16 [lacZ-alpha fragment, 54 aa] 69 >SB_51253| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 85 Score = 105 bits (253), Expect = 7e-23 Identities = 48/54 (88%), Positives = 49/54 (90%) Frame = +2 Query: 695 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPXQQLRSLNGEWQL 856 [lacZ-alpha fragment, 36 aa] P QQLRSLNGEW+L Sbjct: 30 [lacZ-alpha fragment, 54 aa] 83 >SB_45537| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 105 bits (253), Expect = 7e-23 Identities = 48/54 (88%), Positives = 49/54 (90%) Frame = +2 Query: 695 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPXQQLRSLNGEWQL 856 [lacZ-alpha fragment, 36 aa] P QQLRSLNGEW+L Sbjct: 16 [lacZ-alpha fragment, 54 aa] 69 >SB_42518| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 105 bits (253), Expect = 7e-23 Identities = 48/54 (88%), Positives = 49/54 (90%) Frame = +2 Query: 695 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPXQQLRSLNGEWQL 856 [lacZ-alpha fragment, 36 aa] P QQLRSLNGEW+L Sbjct: 16 [lacZ-alpha fragment, 54 aa] 69 >SB_39279| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 105 bits (253), Expect = 7e-23 Identities = 48/54 (88%), Positives = 49/54 (90%) Frame = +2 Query: 695 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPXQQLRSLNGEWQL 856 [lacZ-alpha fragment, 36 aa] P QQLRSLNGEW+L Sbjct: 18 [lacZ-alpha fragment, 54 aa] 71 >SB_36908| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 90 Score = 105 bits (253), Expect = 7e-23 Identities = 48/54 (88%), Positives = 49/54 (90%) Frame = +2 Query: 695 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPXQQLRSLNGEWQL 856 [lacZ-alpha fragment, 36 aa] P QQLRSLNGEW+L Sbjct: 35 [lacZ-alpha fragment, 54 aa] 88 >SB_34602| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 105 bits (253), Expect = 7e-23 Identities = 48/54 (88%), Positives = 49/54 (90%) Frame = +2 Query: 695 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPXQQLRSLNGEWQL 856 [lacZ-alpha fragment, 36 aa] P QQLRSLNGEW+L Sbjct: 37 [lacZ-alpha fragment, 54 aa] 90 >SB_32133| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 105 bits (253), Expect = 7e-23 Identities = 48/54 (88%), Positives = 49/54 (90%) Frame = +2 Query: 695 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPXQQLRSLNGEWQL 856 [lacZ-alpha fragment, 36 aa] P QQLRSLNGEW+L Sbjct: 16 [lacZ-alpha fragment, 54 aa] 69 >SB_31269| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 105 bits (253), Expect = 7e-23 Identities = 48/54 (88%), Positives = 49/54 (90%) Frame = +2 Query: 695 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPXQQLRSLNGEWQL 856 [lacZ-alpha fragment, 36 aa] P QQLRSLNGEW+L Sbjct: 16 [lacZ-alpha fragment, 54 aa] 69 >SB_27230| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 66 Score = 105 bits (253), Expect = 7e-23 Identities = 48/54 (88%), Positives = 49/54 (90%) Frame = +2 Query: 695 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPXQQLRSLNGEWQL 856 [lacZ-alpha fragment, 36 aa] P QQLRSLNGEW+L Sbjct: 11 [lacZ-alpha fragment, 54 aa] 64 >SB_19077| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 105 bits (253), Expect = 7e-23 Identities = 48/54 (88%), Positives = 49/54 (90%) Frame = +2 Query: 695 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAPHRSPXQQLRSLNGEWQL 856 [lacZ-alpha fragment, 36 aa] P QQLRSLNGEW+L Sbjct: 16 [lacZ-alpha fragment, 54 aa] 69 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 30,237,212 Number of Sequences: 59808 Number of extensions: 571172 Number of successful extensions: 6841 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 5025 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6781 length of database: 16,821,457 effective HSP length: 85 effective length of database: 11,737,777 effective search space used: 4612946361 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -