BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030731E7_A11_e657_01.seq (1480 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC4B3.10c |ipk1||inositol 1,3,4,5,6-pentakisphosphate |Schizos... 31 0.53 SPBC17A3.06 |||phosphoprotein phosphatase|Schizosaccharomyces po... 28 3.8 >SPCC4B3.10c |ipk1||inositol 1,3,4,5,6-pentakisphosphate |Schizosaccharomyces pombe|chr 3|||Manual Length = 640 Score = 30.7 bits (66), Expect = 0.53 Identities = 16/50 (32%), Positives = 24/50 (48%) Frame = -2 Query: 321 RPIYRELAQVLQQNNSNRCCRLHRSQCPSRRGMKSGIEYHQLWVVQSPPA 172 +P+ R+ + QN S L+ C + +K GIE W+ QSP A Sbjct: 455 QPVTRDFL-LAAQNASGIYLNLNEQYCLVMKDLKDGIEMKPKWLTQSPAA 503 >SPBC17A3.06 |||phosphoprotein phosphatase|Schizosaccharomyces pombe|chr 2|||Manual Length = 330 Score = 27.9 bits (59), Expect = 3.8 Identities = 9/21 (42%), Positives = 13/21 (61%) Frame = +1 Query: 637 CSSRIWPLRWQGSPCSASAWL 699 C+S+I +WQG CS W+ Sbjct: 292 CNSKIGSYKWQGLQCSCLQWV 312 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 4,056,098 Number of Sequences: 5004 Number of extensions: 71642 Number of successful extensions: 155 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 151 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 155 length of database: 2,362,478 effective HSP length: 76 effective length of database: 1,982,174 effective search space used: 824584384 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -