BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030731E7_A11_e657_01.seq (1480 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 08_01_0389 + 3437383-3437651,3438279-3438396,3438914-3439018,343... 30 5.4 07_03_1685 + 28645284-28645454,28645681-28647069 29 9.4 06_03_1510 + 30665857-30666038,30666137-30666236,30666358-306664... 29 9.4 >08_01_0389 + 3437383-3437651,3438279-3438396,3438914-3439018, 3439983-3440180,3440269-3440355 Length = 258 Score = 29.9 bits (64), Expect = 5.4 Identities = 14/36 (38%), Positives = 19/36 (52%) Frame = +3 Query: 774 VGGIVFLIAFFGCCGAIRESNCMLVTYSIXMLVLMV 881 VG I+F+ + FGC GA R C+ M V+ V Sbjct: 98 VGVILFITSIFGCAGASRGGCCLSFVSKFNMHVIPV 133 >07_03_1685 + 28645284-28645454,28645681-28647069 Length = 519 Score = 29.1 bits (62), Expect = 9.4 Identities = 15/45 (33%), Positives = 28/45 (62%) Frame = +1 Query: 379 CSATSLHRALEQCSPQFVTRNTHLLQSINDIAKKKKKNSRLVLSL 513 CS TSL +LE + R TH LQ++ND ++++ +S +++ + Sbjct: 197 CSNTSLISSLEG----ELDRTTHKLQTLNDRQRRREDSSHILMEI 237 >06_03_1510 + 30665857-30666038,30666137-30666236,30666358-30666438, 30666514-30666618,30666722-30666916,30667440-30667501, 30667870-30667885,30668007-30668068,30668933-30668951 Length = 273 Score = 29.1 bits (62), Expect = 9.4 Identities = 14/43 (32%), Positives = 24/43 (55%), Gaps = 1/43 (2%) Frame = +3 Query: 759 ISAMIVGGIVF-LIAFFGCCGAIRESNCMLVTYSIXMLVLMVL 884 + A++ G+ + L+ GC A S C L Y+I +V+M+L Sbjct: 63 VCALMAAGLFYCLLLLAGCVAAEINSPCFLCFYTILAVVMMLL 105 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 29,185,206 Number of Sequences: 37544 Number of extensions: 540077 Number of successful extensions: 1232 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1186 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1232 length of database: 14,793,348 effective HSP length: 85 effective length of database: 11,602,108 effective search space used: 4722057956 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -