Samia BLAST Result against tribolium

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 030731E7_A09_e641_01.seq
         (1565 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AM292355-1|CAL23167.1|  324|Tribolium castaneum gustatory recept...    23   8.1  

>AM292355-1|CAL23167.1|  324|Tribolium castaneum gustatory receptor
           candidate 34 protein.
          Length = 324

 Score = 22.6 bits (46), Expect = 8.1
 Identities = 15/40 (37%), Positives = 23/40 (57%), Gaps = 2/40 (5%)
 Frame = -3

Query: 789 YSSLHLXSLYGTLLFFKY-*DKVKIFLI-NSSKVAHNFVY 676
           YS+LH  +    L FF++   K + FLI N S V+  F++
Sbjct: 210 YSTLHFVNYIDDLFFFRFEKSKFEPFLISNISLVSLIFLF 249


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 197,869
Number of Sequences: 336
Number of extensions: 4298
Number of successful extensions: 5
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 5
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 5
length of database: 122,585
effective HSP length: 60
effective length of database: 102,425
effective search space used: 47217925
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)