BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030731E7_A09_e641_01.seq (1565 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 10_01_0054 - 773395-774518,776957-777124,777455-778376 30 5.7 10_01_0057 + 797732-797793,797819-797914,798816-799012,799730-80... 29 7.6 >10_01_0054 - 773395-774518,776957-777124,777455-778376 Length = 737 Score = 29.9 bits (64), Expect = 5.7 Identities = 12/31 (38%), Positives = 20/31 (64%) Frame = +3 Query: 153 QNLTYLHSPLSHVIKNQQHKASILVRTDKLI 245 + L Y+HS +SH I++ K + ++ TDK I Sbjct: 528 EGLRYMHSSISHTIRHGDIKPANILLTDKFI 558 >10_01_0057 + 797732-797793,797819-797914,798816-799012,799730-800892 Length = 505 Score = 29.5 bits (63), Expect = 7.6 Identities = 11/31 (35%), Positives = 20/31 (64%) Frame = +3 Query: 153 QNLTYLHSPLSHVIKNQQHKASILVRTDKLI 245 + L Y+HS +SH I++ K + ++ TDK + Sbjct: 283 EGLRYMHSSISHTIRHGDVKPANILLTDKFV 313 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,401,783 Number of Sequences: 37544 Number of extensions: 400803 Number of successful extensions: 765 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 753 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 765 length of database: 14,793,348 effective HSP length: 85 effective length of database: 11,602,108 effective search space used: 5058519088 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -