BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030731E7_A09_e641_01.seq (1565 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_22023| Best HMM Match : RVT_1 (HMM E-Value=0.00027) 32 1.4 SB_37910| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 5.8 >SB_22023| Best HMM Match : RVT_1 (HMM E-Value=0.00027) Length = 364 Score = 31.9 bits (69), Expect = 1.4 Identities = 15/39 (38%), Positives = 21/39 (53%), Gaps = 2/39 (5%) Frame = +2 Query: 83 LVSLKGHR--VAKNIMRVMGRSLT*AEFDLPPLPPFPCH 193 L+S +GH ++KNI + + F PPLP F CH Sbjct: 142 LISARGHPEIISKNIEKEVNLGRMAGPFSAPPLPNFQCH 180 >SB_37910| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 29.9 bits (64), Expect = 5.8 Identities = 14/35 (40%), Positives = 19/35 (54%) Frame = -1 Query: 107 LCDPLTIQAGLVPNXLQPGGXH*XLERPPPRGSXS 3 +C +T+ G VP+ G LERPPPR S + Sbjct: 1 MCVVITLSLGFVPSNSCSPGDPLVLERPPPRWSSN 35 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 24,841,511 Number of Sequences: 59808 Number of extensions: 492200 Number of successful extensions: 2372 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2245 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2372 length of database: 16,821,457 effective HSP length: 85 effective length of database: 11,737,777 effective search space used: 5117670772 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -