BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030731E7_A09_e641_01.seq (1565 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BT025918-1|ABG02162.1| 354|Drosophila melanogaster IP10068p pro... 30 7.5 AE014297-3880|AAF56533.2| 247|Drosophila melanogaster CG8957-PA... 30 7.5 >BT025918-1|ABG02162.1| 354|Drosophila melanogaster IP10068p protein. Length = 354 Score = 30.3 bits (65), Expect = 7.5 Identities = 11/33 (33%), Positives = 20/33 (60%) Frame = -1 Query: 614 VLSEFFQPFRRLPGTNRQTGRRFKNWIYDVGIV 516 +L++F +PFR+ P T RQT + + G++ Sbjct: 133 ILTDFVEPFRKKPLTERQTAYLLRGVVISFGLI 165 >AE014297-3880|AAF56533.2| 247|Drosophila melanogaster CG8957-PA protein. Length = 247 Score = 30.3 bits (65), Expect = 7.5 Identities = 11/33 (33%), Positives = 20/33 (60%) Frame = -1 Query: 614 VLSEFFQPFRRLPGTNRQTGRRFKNWIYDVGIV 516 +L++F +PFR+ P T RQT + + G++ Sbjct: 169 ILTDFVEPFRKKPLTERQTAYLLRGVVISFGLI 201 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 36,291,710 Number of Sequences: 53049 Number of extensions: 712956 Number of successful extensions: 1191 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1167 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1191 length of database: 24,988,368 effective HSP length: 88 effective length of database: 20,320,056 effective search space used: 8798584248 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -