Samia BLAST Result against uniref50

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 030731E7_A08_e633_02.seq
         (1515 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q9HIY9 Cluster: Conserved hypothetical membrane protein...    35   6.4  

>UniRef50_Q9HIY9 Cluster: Conserved hypothetical membrane protein;
           n=1; Thermoplasma acidophilum|Rep: Conserved
           hypothetical membrane protein - Thermoplasma acidophilum
          Length = 390

 Score = 34.7 bits (76), Expect = 6.4
 Identities = 20/54 (37%), Positives = 29/54 (53%)
 Frame = +2

Query: 176 RQPLRGLCVSAVSILFCIFILWYRSAVVKLLPLDGICAARDVANIFGLNIVSEL 337
           R  +R L +S++ I   IFI WY +AV  ++ L G     DV+  F  N +S L
Sbjct: 55  RTLIRWLQLSSLVIEVFIFIAWYLNAVPSIILLSGFLMYVDVSEAFYFNAMSAL 108


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 1,100,547,247
Number of Sequences: 1657284
Number of extensions: 19671488
Number of successful extensions: 34798
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 33557
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 34792
length of database: 575,637,011
effective HSP length: 104
effective length of database: 403,279,475
effective search space used: 161311790000
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)