BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030731E7_A08_e633_02.seq (1515 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_12932| Best HMM Match : zf-C2H2 (HMM E-Value=0.13) 30 5.6 SB_44272| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.4 >SB_12932| Best HMM Match : zf-C2H2 (HMM E-Value=0.13) Length = 577 Score = 29.9 bits (64), Expect = 5.6 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = -1 Query: 279 PSKGSSLTTADLYHSINIQNSMETALTQRPLRGCRGAV 166 P K S T + H + N + TAL++RP++G AV Sbjct: 256 PMKASLKTYCNEGHDVAHANDIHTALSERPVKGTTAAV 293 >SB_44272| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1128 Score = 29.5 bits (63), Expect = 7.4 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = -1 Query: 279 PSKGSSLTTADLYHSINIQNSMETALTQRPLRGCRGAV 166 P K + T + H + N M TAL++RP++G AV Sbjct: 810 PMKAALKTYCNEGHDMANANDMHTALSERPVKGTTAAV 847 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 35,057,735 Number of Sequences: 59808 Number of extensions: 668268 Number of successful extensions: 1171 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1071 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1171 length of database: 16,821,457 effective HSP length: 85 effective length of database: 11,737,777 effective search space used: 4918128563 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -