BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030731E7_A08_e633_02.seq (1515 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ666693-1|ABG29167.1| 250|Apis mellifera MAX dimerization prot... 25 1.3 AB073998-1|BAC76402.1| 339|Apis mellifera preprotachykinin prot... 25 2.3 >DQ666693-1|ABG29167.1| 250|Apis mellifera MAX dimerization protein protein. Length = 250 Score = 25.4 bits (53), Expect = 1.3 Identities = 12/36 (33%), Positives = 19/36 (52%) Frame = -3 Query: 697 PETSRQYELENCAKIK*TVKHTLHRRRSHVLYEKKI 590 PETSR L K K +K R R H ++++++ Sbjct: 79 PETSRHTTLGLLTKAKRFIKSLEERERKHAVHKEQL 114 >AB073998-1|BAC76402.1| 339|Apis mellifera preprotachykinin protein. Length = 339 Score = 24.6 bits (51), Expect = 2.3 Identities = 9/18 (50%), Positives = 13/18 (72%) Frame = -3 Query: 913 GKRNQKGDFKGKXVXXRG 860 GK+N + +F+GK V RG Sbjct: 313 GKKNPRWEFRGKFVGVRG 330 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 324,303 Number of Sequences: 438 Number of extensions: 6720 Number of successful extensions: 9 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 146,343 effective HSP length: 61 effective length of database: 119,625 effective search space used: 52993875 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -