BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030731E7_A08_e633_02.seq (1515 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g27530.1 68416.m03441 vesicle tethering family protein contai... 29 6.1 At3g09085.1 68416.m01068 expressed protein 29 8.0 >At3g27530.1 68416.m03441 vesicle tethering family protein contains Pfam PF04869: Uso1 / p115 like vesicle tethering protein, head region and PF04871: Uso1 / p115 like vesicle tethering protein, C terminal region Length = 914 Score = 29.5 bits (63), Expect = 6.1 Identities = 17/42 (40%), Positives = 26/42 (61%) Frame = -3 Query: 817 VRTKCGSKMLIIHI*KKSMRGEKEIILKILLQSGDTS*GTPE 692 + T C + ++ H+ K ++R KE LKI+L+S S GTPE Sbjct: 452 LETCCRAASILSHVVKDNLRC-KEKALKIVLESPMPSMGTPE 492 >At3g09085.1 68416.m01068 expressed protein Length = 112 Score = 29.1 bits (62), Expect = 8.0 Identities = 15/44 (34%), Positives = 24/44 (54%) Frame = +2 Query: 137 PFVLARHSLLTAPRQPLRGLCVSAVSILFCIFILWYRSAVVKLL 268 PF + +HS + R G+ S V+++ I I W+ A+V LL Sbjct: 11 PFYMMQHSNPSTRRLHFIGIIASIVALICSILINWWFLALVPLL 54 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 24,096,850 Number of Sequences: 28952 Number of extensions: 443576 Number of successful extensions: 730 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 720 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 730 length of database: 12,070,560 effective HSP length: 84 effective length of database: 9,638,592 effective search space used: 4048208640 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -