BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030731E7_A07_e625_01.seq (1581 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_44821| Best HMM Match : Ribophorin_II (HMM E-Value=3.5e-15) 44 3e-04 >SB_44821| Best HMM Match : Ribophorin_II (HMM E-Value=3.5e-15) Length = 512 Score = 44.0 bits (99), Expect = 3e-04 Identities = 37/151 (24%), Positives = 72/151 (47%), Gaps = 2/151 (1%) Frame = +3 Query: 213 AISNANILAGTIELKRLQSILEDSLKSKDISSLYYAVKGLKLLKAPIPDICEDIKTIKYD 392 A A++L+ E RL+ +++ +D+ + +YA+KGLK KAP+P K ++ + Sbjct: 19 AAKPASVLS-VAEQARLRQTFQEAAPFRDLETAHYALKGLKFFKAPMPPNQNVCKFVEDN 77 Query: 393 VKNIEQIFQLTNAAALTDCVNFLKPEVLSTPAQVLD--KKDATLSEIYYSVYALKALGKG 566 V I + +A+++ + + + + D ++ A S I+Y+V +L L G Sbjct: 78 VDR-SSILSVYHASSIIKVLGNCQLNLKDAEQMLADSIQEGAPTSTIFYAVSSLSNL--G 134 Query: 567 SVFDKEDALKNLIQLLKKDDSPVNYGYVFAL 659 D LK + D+ V+ +FA+ Sbjct: 135 LKIDSAAVLKAVRAASSSDEDSVS-SAIFAM 164 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 34,895,553 Number of Sequences: 59808 Number of extensions: 595130 Number of successful extensions: 1265 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1139 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1258 length of database: 16,821,457 effective HSP length: 85 effective length of database: 11,737,777 effective search space used: 5176359657 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -