BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030731E7_A05_e609_01.seq (1526 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q8VSX0 Cluster: AgrC; n=2; Staphylococcus simulans|Rep:... 36 2.8 UniRef50_Q9RUC8 Cluster: Putative uncharacterized protein; n=1; ... 34 8.6 >UniRef50_Q8VSX0 Cluster: AgrC; n=2; Staphylococcus simulans|Rep: AgrC - Staphylococcus simulans Length = 224 Score = 35.9 bits (79), Expect = 2.8 Identities = 25/89 (28%), Positives = 45/89 (50%) Frame = +2 Query: 383 FRVIISNTLHL*IITKIYQAKRRQNDIICKYVS*RIKTINSCYITDRYRIKIFDVFIGFC 562 F +I+ +T++L TK+Y ++ Y+ + I+S I D+ + I V+ + Sbjct: 57 FIIILIDTIYLYRKTKLYSILTMVGSVLIIYLG-NLSAISSFLILDQEKTNIIIVYAVYL 115 Query: 563 SGHLFTFTSNQHAYFMEFILTKTIRSIIT 649 LFT TS AY + FI+ K +S ++ Sbjct: 116 --FLFTVTSLILAYLVRFIIQKLKKSYLS 142 >UniRef50_Q9RUC8 Cluster: Putative uncharacterized protein; n=1; Deinococcus radiodurans|Rep: Putative uncharacterized protein - Deinococcus radiodurans Length = 1940 Score = 34.3 bits (75), Expect = 8.6 Identities = 16/39 (41%), Positives = 20/39 (51%) Frame = +2 Query: 1064 SXPKRGPKRLRAWGPFQARNFLKPXPTPPRFLLXXRWXP 1180 S P R P+R RAW P F+ P+P R+ RW P Sbjct: 1901 SPPSRAPRRARAWSP---GRFVSVSPSPTRWPGAPRWSP 1936 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,161,611,017 Number of Sequences: 1657284 Number of extensions: 19952256 Number of successful extensions: 34653 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 32612 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 34550 length of database: 575,637,011 effective HSP length: 104 effective length of database: 403,279,475 effective search space used: 162924907900 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -