BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030731E7_A05_e609_01.seq (1526 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC1709.20 |pop8||RNase P and RNase MRP subunit Pop8 |Schizosac... 30 0.97 SPBC691.03c |apl3||AP-2 adaptor complex subunit Alp3 |Schizosacc... 29 2.2 >SPBC1709.20 |pop8||RNase P and RNase MRP subunit Pop8 |Schizosaccharomyces pombe|chr 2|||Manual Length = 108 Score = 29.9 bits (64), Expect = 0.97 Identities = 14/36 (38%), Positives = 18/36 (50%), Gaps = 3/36 (8%) Frame = -2 Query: 754 FSIFAINLPV---HESS*LCYLRCHKNSTKNIFLFL 656 F IF +P+ H S YLRCHK K + + L Sbjct: 45 FGIFGSAIPIDFLHRQSKFLYLRCHKEDKKKVLVAL 80 >SPBC691.03c |apl3||AP-2 adaptor complex subunit Alp3 |Schizosaccharomyces pombe|chr 2|||Manual Length = 878 Score = 28.7 bits (61), Expect = 2.2 Identities = 18/52 (34%), Positives = 25/52 (48%), Gaps = 2/52 (3%) Frame = +3 Query: 765 FLPGSQEPVHKKXQPSANTXTXWDT--QFLPTFSTXXVSCPLPAYPIIIHLP 914 FL G+++ VH K +PS+ DT Q +P S +P Y I LP Sbjct: 591 FLDGNRDGVHPKSRPSSKVNLV-DTYPQTIPNVSKPSTPIDVPEYDISACLP 641 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 4,725,143 Number of Sequences: 5004 Number of extensions: 84329 Number of successful extensions: 168 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 157 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 168 length of database: 2,362,478 effective HSP length: 76 effective length of database: 1,982,174 effective search space used: 856299168 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -