BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= 030731E7_A05_e609_01.seq
(1526 letters)
Database: mosquito
2352 sequences; 563,979 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
AY170874-1|AAO34131.1| 1221|Anopheles gambiae alkali metal ion/p... 25 4.4
>AY170874-1|AAO34131.1| 1221|Anopheles gambiae alkali metal
ion/proton exchanger 3 protein.
Length = 1221
Score = 25.4 bits (53), Expect = 4.4
Identities = 14/36 (38%), Positives = 21/36 (58%)
Frame = -3
Query: 612 SMKYAC*LLVNVNKCPLQNPMKTSKILMRYLSVM*Q 505
++ +A LLV+VN PLQ T+ I + Y +V Q
Sbjct: 606 AVAFALVLLVDVNHIPLQPMFLTTTIAVVYFTVFLQ 641
Database: mosquito
Posted date: Oct 23, 2007 1:18 PM
Number of letters in database: 563,979
Number of sequences in database: 2352
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 1,238,324
Number of Sequences: 2352
Number of extensions: 23112
Number of successful extensions: 24
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 22
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 24
length of database: 563,979
effective HSP length: 67
effective length of database: 406,395
effective search space used: 179220195
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -