BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030725E6_H05_e520_15.seq (1619 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAPB24D3.03 |||agmatinase |Schizosaccharomyces pombe|chr 1|||Ma... 28 3.2 SPBC839.06 |cta3||P-type ATPase, calcium transporting Cta3|Schiz... 28 4.2 >SPAPB24D3.03 |||agmatinase |Schizosaccharomyces pombe|chr 1|||Manual Length = 385 Score = 28.3 bits (60), Expect = 3.2 Identities = 15/43 (34%), Positives = 19/43 (44%) Frame = +1 Query: 253 DPFKSTKYLVDCGTQDAINYNQLYLREVLTPEIFSTVLGAPRS 381 +PFKS LVDCG Y+ L + L F + P S Sbjct: 109 NPFKSWAKLVDCGDIPVTTYDILKAMDQLESAYFQLIARKPSS 151 >SPBC839.06 |cta3||P-type ATPase, calcium transporting Cta3|Schizosaccharomyces pombe|chr 2|||Manual Length = 1037 Score = 27.9 bits (59), Expect = 4.2 Identities = 10/33 (30%), Positives = 18/33 (54%) Frame = +1 Query: 169 LAFLLAVFEIGTCLRCYQCNSQQDPGCGDPFKS 267 + +++ ++ GT Y CN+ GC D FK+ Sbjct: 856 MTWVVIMYGFGTGNLSYDCNAHYHAGCNDVFKA 888 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,791,935 Number of Sequences: 5004 Number of extensions: 67917 Number of successful extensions: 157 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 154 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 157 length of database: 2,362,478 effective HSP length: 76 effective length of database: 1,982,174 effective search space used: 917746562 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -