BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030725E6_H04_e512_16.seq (1468 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC1773.15 |||membrane transporter|Schizosaccharomyces pombe|ch... 28 2.8 SPAC9.03c |brr2|spp41|U5 snRNP complex subunit Brr2 |Schizosacch... 27 8.6 >SPBC1773.15 |||membrane transporter|Schizosaccharomyces pombe|chr 2|||Manual Length = 497 Score = 28.3 bits (60), Expect = 2.8 Identities = 16/46 (34%), Positives = 23/46 (50%) Frame = -1 Query: 343 TIKLSTAVTNLVLQKVTQSFFVRKKTLLRALSLIHSLFSCNIMRTV 206 ++ LST + L KVT +F V L+ L+HS S RT+ Sbjct: 104 SLPLSTLLQKFPLSKVTSAFIVAWGILMTLTCLVHSYASYIATRTL 149 >SPAC9.03c |brr2|spp41|U5 snRNP complex subunit Brr2 |Schizosaccharomyces pombe|chr 1|||Manual Length = 2176 Score = 26.6 bits (56), Expect = 8.6 Identities = 13/39 (33%), Positives = 22/39 (56%) Frame = +3 Query: 123 QSGLRSLDLFTSFSQRCYSALVEPIVSSTVRIILQLNNE 239 + G R ++ SF + A V+PI S VR+ L +N++ Sbjct: 1207 KEGRRVYNMVQSFPRLSVEAHVQPITRSLVRVELVINSQ 1245 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 4,232,259 Number of Sequences: 5004 Number of extensions: 72748 Number of successful extensions: 163 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 157 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 163 length of database: 2,362,478 effective HSP length: 76 effective length of database: 1,982,174 effective search space used: 816655688 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -