BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030725E6_H03_e504_15.seq (1523 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY146721-1|AAO12081.1| 144|Anopheles gambiae odorant-binding pr... 25 4.4 AF437884-1|AAL84179.1| 144|Anopheles gambiae odorant binding pr... 25 4.4 >AY146721-1|AAO12081.1| 144|Anopheles gambiae odorant-binding protein AgamOBP1 protein. Length = 144 Score = 25.4 bits (53), Expect = 4.4 Identities = 15/53 (28%), Positives = 26/53 (49%) Frame = -1 Query: 788 LSALHRQLHNSVDDVRLVVPERTDSPSP*NVCLRHYYLHVFLVHSGVIYAFLV 630 L LH L +S+ D+ + + +R P +C + ++LH S + FLV Sbjct: 92 LEKLHDSLPSSMHDIAMHMGKRCLYPEGETLCDKAFWLHKCWKQSDPKHYFLV 144 >AF437884-1|AAL84179.1| 144|Anopheles gambiae odorant binding protein protein. Length = 144 Score = 25.4 bits (53), Expect = 4.4 Identities = 15/53 (28%), Positives = 26/53 (49%) Frame = -1 Query: 788 LSALHRQLHNSVDDVRLVVPERTDSPSP*NVCLRHYYLHVFLVHSGVIYAFLV 630 L LH L +S+ D+ + + +R P +C + ++LH S + FLV Sbjct: 92 LEKLHDSLPSSMHDIAMHMGKRCLYPEGETLCDKAFWLHKCWKQSDPKHYFLV 144 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,139,842 Number of Sequences: 2352 Number of extensions: 20030 Number of successful extensions: 40 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 39 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 40 length of database: 563,979 effective HSP length: 67 effective length of database: 406,395 effective search space used: 178813800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -