Samia BLAST Result against bee

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 030725E6_H03_e504_15.seq
         (1523 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AB193550-1|BAD66824.1|  699|Apis mellifera soluble guanylyl cycl...    27   0.56 

>AB193550-1|BAD66824.1|  699|Apis mellifera soluble guanylyl cyclase
           alpha 1 subunit protein.
          Length = 699

 Score = 26.6 bits (56), Expect = 0.56
 Identities = 15/54 (27%), Positives = 28/54 (51%), Gaps = 2/54 (3%)
 Frame = +3

Query: 306 DIVSKAKQSRGEKKARKIMSKLGLKLVQGVNRVTIRKSKNI--LFVINNPDVFK 461
           D++   +Q+R +   R+ M KL   + +    V+  + KN+  L +I  PD+ K
Sbjct: 421 DVILVGEQARAQDGLRRRMDKLKSSIEEANLAVSAEREKNVSLLHLIFPPDIAK 474


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 306,360
Number of Sequences: 438
Number of extensions: 5978
Number of successful extensions: 9
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 9
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 9
length of database: 146,343
effective HSP length: 61
effective length of database: 119,625
effective search space used: 53352750
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)