BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030725E6_G09_e551_13.seq (1508 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value EF519508-1|ABP73571.1| 250|Anopheles gambiae APL2 protein. 24 10.0 AY263175-1|AAP78790.1| 814|Anopheles gambiae TmcA-like protein ... 24 10.0 >EF519508-1|ABP73571.1| 250|Anopheles gambiae APL2 protein. Length = 250 Score = 24.2 bits (50), Expect = 10.0 Identities = 14/30 (46%), Positives = 18/30 (60%) Frame = -3 Query: 486 NPARTLGST*HITNGSTVIFVLNAHKSLTN 397 N RT+ ST TNGS +I + AH LT+ Sbjct: 166 NGIRTVEST--ATNGSELILLKLAHNKLTS 193 >AY263175-1|AAP78790.1| 814|Anopheles gambiae TmcA-like protein protein. Length = 814 Score = 24.2 bits (50), Expect = 10.0 Identities = 13/38 (34%), Positives = 20/38 (52%) Frame = +2 Query: 380 SINIKEFVKDLWAFRTKITVEPFVICYVLPSVLAGLAV 493 S++IKE D W R +ITV +I + P + L + Sbjct: 357 SMDIKE--SDSWWRRNEITVVMSLISFFFPMIFEALGI 392 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,138,056 Number of Sequences: 2352 Number of extensions: 20853 Number of successful extensions: 32 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 30 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 32 length of database: 563,979 effective HSP length: 67 effective length of database: 406,395 effective search space used: 176781825 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -