BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030725E6_G07_e535_13.seq (1522 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY884061-1|AAX84202.1| 717|Tribolium castaneum laccase 2A protein. 23 4.5 >AY884061-1|AAX84202.1| 717|Tribolium castaneum laccase 2A protein. Length = 717 Score = 23.4 bits (48), Expect = 4.5 Identities = 18/53 (33%), Positives = 22/53 (41%), Gaps = 1/53 (1%) Frame = +2 Query: 200 VKLIDEVIYEVTGKTVIRTQDDIHIDGF-NPSAEEADEGTDSNVETGVDIVLN 355 + LIDE+ Y +I DDI F N AD + VDI LN Sbjct: 525 ISLIDEISYMAPPAPLISQYDDIDPQQFCNGDNRPADCQQNCMCTHKVDIPLN 577 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 274,006 Number of Sequences: 336 Number of extensions: 5386 Number of successful extensions: 9 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 122,585 effective HSP length: 60 effective length of database: 102,425 effective search space used: 45681550 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -