BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030725E6_G07_e535_13.seq (1522 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_21409| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 1e-05 >SB_21409| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 195 Score = 48.8 bits (111), Expect = 1e-05 Identities = 45/151 (29%), Positives = 69/151 (45%), Gaps = 13/151 (8%) Frame = +2 Query: 263 DIHIDGFNPSAEEADEGTDSNVETGVDIVLNHRLVETYAFGDKKSYTLYLKDYMKKLVAK 442 D ++ G N SAE+A + + TG ++V+ +RLVE + K K Y+KK+ Sbjct: 47 DENLIGGNKSAEDACDDVEDGCTTGCNVVMANRLVE-IPYKTFKELLAEFKPYIKKVKEH 105 Query: 443 L-EEKAPD-QVDIFKTNMNKVMKDILARFKDLQFFTGESMDCD-----GMVAMMEY--RN 595 + EE PD +V F+ + I FK+ QFF DCD + M Y ++ Sbjct: 106 MKEEGCPDEEVKGFEKAAMDYILSIKKNFKEYQFF---QPDCDLGGGAHCIVFMWYPEKD 162 Query: 596 INGTD----VPFMMFFKHGLDEEKF*GVCIY 676 + G D P + FKH + + K G Y Sbjct: 163 LRGVDQDGFSPVLTVFKHAVKQVKVVGFLSY 193 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 35,809,801 Number of Sequences: 59808 Number of extensions: 670115 Number of successful extensions: 1462 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1345 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1462 length of database: 16,821,457 effective HSP length: 85 effective length of database: 11,737,777 effective search space used: 4941604117 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -