Samia BLAST Result against mosquito

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 030725E6_G07_e535_13.seq
         (1522 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY943928-1|AAX49501.1|  753|Anopheles gambiae laccase-2 isoform ...    27   1.4  

>AY943928-1|AAX49501.1|  753|Anopheles gambiae laccase-2 isoform A
           protein.
          Length = 753

 Score = 27.1 bits (57), Expect = 1.4
 Identities = 18/53 (33%), Positives = 25/53 (47%), Gaps = 1/53 (1%)
 Frame = +2

Query: 200 VKLIDEVIYEVTGKTVIRTQDDIHIDGF-NPSAEEADEGTDSNVETGVDIVLN 355
           + LIDE+ Y      ++   DDI+ + F N     AD G +      VDI LN
Sbjct: 567 ISLIDEISYLSAPAPLLSQYDDINPEQFCNGDNRPADCGANCMCTHKVDIPLN 619


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 1,200,255
Number of Sequences: 2352
Number of extensions: 21997
Number of successful extensions: 77
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 77
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 77
length of database: 563,979
effective HSP length: 67
effective length of database: 406,395
effective search space used: 178407405
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)