BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= 030725E6_G07_e535_13.seq
(1522 letters)
Database: mosquito
2352 sequences; 563,979 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
AY943928-1|AAX49501.1| 753|Anopheles gambiae laccase-2 isoform ... 27 1.4
>AY943928-1|AAX49501.1| 753|Anopheles gambiae laccase-2 isoform A
protein.
Length = 753
Score = 27.1 bits (57), Expect = 1.4
Identities = 18/53 (33%), Positives = 25/53 (47%), Gaps = 1/53 (1%)
Frame = +2
Query: 200 VKLIDEVIYEVTGKTVIRTQDDIHIDGF-NPSAEEADEGTDSNVETGVDIVLN 355
+ LIDE+ Y ++ DDI+ + F N AD G + VDI LN
Sbjct: 567 ISLIDEISYLSAPAPLLSQYDDINPEQFCNGDNRPADCGANCMCTHKVDIPLN 619
Database: mosquito
Posted date: Oct 23, 2007 1:18 PM
Number of letters in database: 563,979
Number of sequences in database: 2352
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 1,200,255
Number of Sequences: 2352
Number of extensions: 21997
Number of successful extensions: 77
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 77
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 77
length of database: 563,979
effective HSP length: 67
effective length of database: 406,395
effective search space used: 178407405
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -