BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030725E6_G06_e527_14.seq (1554 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_01_0128 - 1167904-1168749,1168790-1168863,1169419-1169491,117... 33 0.61 04_04_1377 - 33064906-33065607 31 1.9 01_03_0055 + 12074512-12076155 29 7.5 12_01_0403 - 3185897-3186931,3187200-3187311,3187425-3187735,318... 29 9.9 06_03_0094 + 16573075-16573268,16574636-16574996 29 9.9 05_01_0490 + 4083768-4083775,4083845-4084336,4084441-4084522,408... 29 9.9 >01_01_0128 - 1167904-1168749,1168790-1168863,1169419-1169491, 1171148-1171398,1171442-1171687,1172220-1172415, 1172796-1172876,1172966-1173169,1173671-1173880, 1173953-1174174,1174437-1174480,1174974-1175052, 1175066-1175227,1175337-1175564,1175786-1175815, 1175905-1176273,1176356-1176571,1177202-1177683, 1177930-1177975 Length = 1352 Score = 33.1 bits (72), Expect = 0.61 Identities = 12/25 (48%), Positives = 17/25 (68%) Frame = +1 Query: 283 RQHEHRIHSESRAHQHNHRRPRGDD 357 R+ + HS SR+H+H+H R GDD Sbjct: 1225 RRSSKKDHSSSRSHRHHHHRSSGDD 1249 >04_04_1377 - 33064906-33065607 Length = 233 Score = 31.5 bits (68), Expect = 1.9 Identities = 14/47 (29%), Positives = 22/47 (46%) Frame = +1 Query: 229 GDRVQSRR*GVRAAKKQ*RQHEHRIHSESRAHQHNHRRPRGDDEHAH 369 G RV + + G+ A E + H H H H +P G+++H H Sbjct: 157 GSRVDALQTGMMVAPTT-HHRERQKHHHHHHHHHPHLQPHGEEQHHH 202 >01_03_0055 + 12074512-12076155 Length = 547 Score = 29.5 bits (63), Expect = 7.5 Identities = 10/21 (47%), Positives = 13/21 (61%) Frame = +1 Query: 295 HRIHSESRAHQHNHRRPRGDD 357 HR+H H +H+R RGDD Sbjct: 357 HRVHHHHHHHNGHHKRRRGDD 377 >12_01_0403 - 3185897-3186931,3187200-3187311,3187425-3187735, 3188112-3188324,3188834-3189052 Length = 629 Score = 29.1 bits (62), Expect = 9.9 Identities = 23/83 (27%), Positives = 34/83 (40%) Frame = +2 Query: 242 SQDAKECVLRRNSNVSMNIEFTPNQELTSITTDVHGVMMNMPIPFPLADRDACKDKGLTC 421 S K+ + R + + F EL S TTD G N L D C ++ LT Sbjct: 386 SLSTKDAYIVREGDPVSEMLFVIRGELESSTTD--GGRTNFFSSITLRPGDFCGEELLTW 443 Query: 422 PLQPNVLANYTATLPVLKSYPKV 490 L PN N+ + ++S +V Sbjct: 444 ALMPNPSLNFPQSTRTVRSVTEV 466 >06_03_0094 + 16573075-16573268,16574636-16574996 Length = 184 Score = 29.1 bits (62), Expect = 9.9 Identities = 13/33 (39%), Positives = 19/33 (57%) Frame = +2 Query: 341 VHGVMMNMPIPFPLADRDACKDKGLTCPLQPNV 439 +HG ++++P P P A DA + TCP P V Sbjct: 18 LHGCLVSLPPPPPPALEDARNHRHTTCPRLPPV 50 >05_01_0490 + 4083768-4083775,4083845-4084336,4084441-4084522, 4086671-4087357,4087555-4087813,4088435-4088558, 4089474-4089564 Length = 580 Score = 29.1 bits (62), Expect = 9.9 Identities = 17/62 (27%), Positives = 32/62 (51%) Frame = +2 Query: 293 NIEFTPNQELTSITTDVHGVMMNMPIPFPLADRDACKDKGLTCPLQPNVLANYTATLPVL 472 +I +PN + ++++D G + + A+ DA K + T Q N NY +T+PV Sbjct: 435 SIALSPNVQWLAVSSD-KGTVHVFSLRVKDAEEDAKKGESATAGAQVNDNCNYGSTVPVT 493 Query: 473 KS 478 ++ Sbjct: 494 QT 495 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 31,189,978 Number of Sequences: 37544 Number of extensions: 562097 Number of successful extensions: 1115 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 1046 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1100 length of database: 14,793,348 effective HSP length: 85 effective length of database: 11,602,108 effective search space used: 5012110656 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -