BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030725E6_G06_e527_14.seq (1554 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ303468-1|ABC18327.1| 1115|Anopheles gambiae putative methopren... 25 5.9 DQ219482-1|ABB29886.1| 545|Anopheles gambiae cryptochrome 1 pro... 25 5.9 AY705396-1|AAU12505.1| 710|Anopheles gambiae nicotinic acetylch... 25 7.8 >DQ303468-1|ABC18327.1| 1115|Anopheles gambiae putative methoprene-tolerant protein protein. Length = 1115 Score = 25.0 bits (52), Expect = 5.9 Identities = 8/27 (29%), Positives = 13/27 (48%) Frame = +1 Query: 286 QHEHRIHSESRAHQHNHRRPRGDDEHA 366 Q +H HS+ H H+H +H+ Sbjct: 174 QQQHPGHSQHHHHHHHHHPHHSQQQHS 200 >DQ219482-1|ABB29886.1| 545|Anopheles gambiae cryptochrome 1 protein. Length = 545 Score = 25.0 bits (52), Expect = 5.9 Identities = 9/30 (30%), Positives = 15/30 (50%) Frame = +2 Query: 461 LPVLKSYPKVSVDVKWELKNENNVDIICIL 550 LP L +YP V W+ E ++ C++ Sbjct: 455 LPELANYPAQFVHEPWKASREQQIEYGCVI 484 >AY705396-1|AAU12505.1| 710|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 3 protein. Length = 710 Score = 24.6 bits (51), Expect = 7.8 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +1 Query: 298 RIHSESRAHQHNHRRPRGDDEHAH 369 R+H S H HNHR G H H Sbjct: 414 RLHG-SPTHLHNHRSGGGGRHHHH 436 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,222,953 Number of Sequences: 2352 Number of extensions: 22262 Number of successful extensions: 34 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 31 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 34 length of database: 563,979 effective HSP length: 67 effective length of database: 406,395 effective search space used: 182877750 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -