BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030725E6_G04_e511_14.seq (1524 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. 26 0.64 AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. 26 0.64 AY074761-1|AAL71874.1| 314|Tribolium castaneum ultrabithorax pr... 25 2.0 AF146649-1|AAD38009.1| 96|Tribolium castaneum ultrathorax prot... 25 2.0 AY043292-1|AAK96031.1| 323|Tribolium castaneum homeodomain tran... 23 6.0 AF228509-1|AAF69136.1| 325|Tribolium castaneum prothoraxless pr... 23 6.0 >AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. Length = 790 Score = 26.2 bits (55), Expect = 0.64 Identities = 15/44 (34%), Positives = 20/44 (45%), Gaps = 1/44 (2%) Frame = -3 Query: 358 PLLVPDPTSPYRILHLLLHYPQTHPTHLTPRNR-NRNRHRILPP 230 P ++ P +P+ + L P HP H PRN N H I P Sbjct: 718 PYMLQSPLTPHEAFDVKLP-PPPHPHHQPPRNPVGTNPHDINNP 760 >AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. Length = 682 Score = 26.2 bits (55), Expect = 0.64 Identities = 15/44 (34%), Positives = 20/44 (45%), Gaps = 1/44 (2%) Frame = -3 Query: 358 PLLVPDPTSPYRILHLLLHYPQTHPTHLTPRNR-NRNRHRILPP 230 P ++ P +P+ + L P HP H PRN N H I P Sbjct: 610 PYMLQSPLTPHEAFDVKLP-PPPHPHHQPPRNPVGTNPHDINNP 652 >AY074761-1|AAL71874.1| 314|Tribolium castaneum ultrabithorax protein. Length = 314 Score = 24.6 bits (51), Expect = 2.0 Identities = 16/65 (24%), Positives = 35/65 (53%), Gaps = 1/65 (1%) Frame = +2 Query: 164 KTISRTKNLK-KKMTHTNRLMRKRRKNPMTVPITIPRRQMSRMRLGIVKKKMKNPVRTGR 340 +T +R + L+ +K HTN + +RR+ M + + RQ+ ++ + K+K ++ + Sbjct: 228 QTYTRYQTLELEKEFHTNHYLTRRRRIEMAHALCLTERQI-KIWFQNRRMKLKKEIQAIK 286 Query: 341 IWNEK 355 NE+ Sbjct: 287 ELNEQ 291 >AF146649-1|AAD38009.1| 96|Tribolium castaneum ultrathorax protein. Length = 96 Score = 24.6 bits (51), Expect = 2.0 Identities = 16/65 (24%), Positives = 35/65 (53%), Gaps = 1/65 (1%) Frame = +2 Query: 164 KTISRTKNLK-KKMTHTNRLMRKRRKNPMTVPITIPRRQMSRMRLGIVKKKMKNPVRTGR 340 +T +R + L+ +K HTN + +RR+ M + + RQ+ ++ + K+K ++ + Sbjct: 10 QTYTRYQTLELEKEFHTNHYLTRRRRIEMAHALCLTERQI-KIWFQNRRMKLKKEIQAIK 68 Query: 341 IWNEK 355 NE+ Sbjct: 69 ELNEQ 73 >AY043292-1|AAK96031.1| 323|Tribolium castaneum homeodomain transcription factor Prothoraxlessprotein. Length = 323 Score = 23.0 bits (47), Expect = 6.0 Identities = 9/14 (64%), Positives = 10/14 (71%) Frame = -1 Query: 1305 KXXNKSKGEGXXEG 1264 K NK+KGEG EG Sbjct: 298 KKENKTKGEGGSEG 311 >AF228509-1|AAF69136.1| 325|Tribolium castaneum prothoraxless protein. Length = 325 Score = 23.0 bits (47), Expect = 6.0 Identities = 9/14 (64%), Positives = 10/14 (71%) Frame = -1 Query: 1305 KXXNKSKGEGXXEG 1264 K NK+KGEG EG Sbjct: 300 KKENKTKGEGGSEG 313 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 197,503 Number of Sequences: 336 Number of extensions: 3264 Number of successful extensions: 13 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 122,585 effective HSP length: 60 effective length of database: 102,425 effective search space used: 45783975 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -