BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030725E6_G04_e511_14.seq (1524 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_35651| Best HMM Match : NUMOD3 (HMM E-Value=3.2) 39 0.009 SB_10578| Best HMM Match : NUMOD3 (HMM E-Value=3.2) 39 0.009 SB_10182| Best HMM Match : Transformer (HMM E-Value=9.9) 38 0.021 SB_5523| Best HMM Match : Extensin_2 (HMM E-Value=0.0052) 38 0.021 SB_4199| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.028 SB_59404| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.037 SB_23345| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.049 SB_28630| Best HMM Match : DUF1665 (HMM E-Value=3.4) 36 0.065 SB_22653| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.085 SB_910| Best HMM Match : Cation_efflux (HMM E-Value=0.056) 35 0.15 SB_22966| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.20 SB_621| Best HMM Match : SNF2_N (HMM E-Value=0) 34 0.26 SB_10690| Best HMM Match : Pkinase (HMM E-Value=6.4e-08) 34 0.34 SB_31213| Best HMM Match : SNF2_N (HMM E-Value=0) 34 0.34 SB_26185| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.34 SB_48197| Best HMM Match : Neuromodulin (HMM E-Value=2.5) 33 0.46 SB_40651| Best HMM Match : Neuromodulin (HMM E-Value=1.2) 33 0.46 SB_27558| Best HMM Match : dsrm (HMM E-Value=9.6e-18) 33 0.46 SB_17956| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.46 SB_3059| Best HMM Match : REJ (HMM E-Value=4.8e-06) 33 0.46 SB_25447| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.60 SB_9795| Best HMM Match : FF (HMM E-Value=2.3e-33) 33 0.60 SB_48206| Best HMM Match : LTXXQ (HMM E-Value=3) 33 0.80 SB_29377| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.80 SB_24438| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.80 SB_26314| Best HMM Match : SURF6 (HMM E-Value=2.8) 32 1.1 SB_35523| Best HMM Match : RVT_1 (HMM E-Value=0) 32 1.1 SB_9657| Best HMM Match : P_proprotein (HMM E-Value=7.5e-29) 32 1.4 SB_12735| Best HMM Match : PT (HMM E-Value=0.36) 32 1.4 SB_10489| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.8 SB_45809| Best HMM Match : Vicilin_N (HMM E-Value=4.5) 31 1.8 SB_23985| Best HMM Match : CRAM_rpt (HMM E-Value=3.4) 31 1.8 SB_22497| Best HMM Match : Ras (HMM E-Value=7.7e-07) 31 1.8 SB_21715| Best HMM Match : Serglycin (HMM E-Value=0.054) 31 1.8 SB_12617| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.8 SB_53468| Best HMM Match : E-MAP-115 (HMM E-Value=4.2) 31 2.4 SB_49989| Best HMM Match : GRP (HMM E-Value=2.3) 31 2.4 SB_39433| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 2.4 SB_33470| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 2.4 SB_6619| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 2.4 SB_35177| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.2 SB_8346| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.2 SB_41631| Best HMM Match : Ank (HMM E-Value=0.00018) 31 3.2 SB_12670| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 3.2 SB_29507| Best HMM Match : E-MAP-115 (HMM E-Value=5.1) 30 4.2 SB_45236| Best HMM Match : PRP38 (HMM E-Value=0) 30 4.2 SB_47990| Best HMM Match : RRM_1 (HMM E-Value=7.8e-28) 30 5.6 SB_28619| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 5.6 SB_7913| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 5.6 SB_21838| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 5.6 SB_20424| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 5.6 SB_59216| Best HMM Match : DUF1540 (HMM E-Value=0.25) 29 7.4 SB_36660| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 7.4 SB_39925| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 9.8 SB_20358| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 9.8 SB_12780| Best HMM Match : SAC3_GANP (HMM E-Value=3.7e-07) 29 9.8 SB_11304| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 9.8 SB_3033| Best HMM Match : RRM_1 (HMM E-Value=2.3e-20) 29 9.8 SB_27758| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 9.8 >SB_35651| Best HMM Match : NUMOD3 (HMM E-Value=3.2) Length = 228 Score = 39.1 bits (87), Expect = 0.009 Identities = 21/51 (41%), Positives = 25/51 (49%), Gaps = 5/51 (9%) Frame = +1 Query: 637 KHHKSSHHERDRKS-----EHNKSSSKDSKRHSGDQKSHKRARDESRENDR 774 K H +H +D+K EH S KDSK H DQKSH +D DR Sbjct: 113 KDHPKNHPSKDQKGSKETKEHKDSKDKDSKEHK-DQKSHNHHKDPRGHKDR 162 Score = 35.9 bits (79), Expect = 0.085 Identities = 16/46 (34%), Positives = 25/46 (54%), Gaps = 1/46 (2%) Frame = +1 Query: 640 HHKSSHHERDRKSEHNKSSSKDSKRHSGDQ-KSHKRARDESRENDR 774 HHK HH +H+ KD K H+ DQ K HK +D ++++ + Sbjct: 69 HHKKGHHR-----DHHHKDHKDQKDHAKDQSKDHKDQKDHAKDHSK 109 Score = 33.5 bits (73), Expect = 0.46 Identities = 19/48 (39%), Positives = 26/48 (54%), Gaps = 2/48 (4%) Frame = +1 Query: 637 KHHKSSHHERDRKSE--HNKSSSKDSKRHSGDQKSHKRARDESRENDR 774 K H HH +D K + H K SKD K DQK H A+D S+++ + Sbjct: 72 KGHHRDHHHKDHKDQKDHAKDQSKDHK----DQKDH--AKDHSKDHPK 113 >SB_10578| Best HMM Match : NUMOD3 (HMM E-Value=3.2) Length = 379 Score = 39.1 bits (87), Expect = 0.009 Identities = 21/51 (41%), Positives = 25/51 (49%), Gaps = 5/51 (9%) Frame = +1 Query: 637 KHHKSSHHERDRKS-----EHNKSSSKDSKRHSGDQKSHKRARDESRENDR 774 K H +H +D+K EH S KDSK H DQKSH +D DR Sbjct: 54 KDHPKNHPSKDQKGSKETKEHKDSKDKDSKEHK-DQKSHNHHKDPRGHKDR 103 Score = 35.9 bits (79), Expect = 0.085 Identities = 16/46 (34%), Positives = 25/46 (54%), Gaps = 1/46 (2%) Frame = +1 Query: 640 HHKSSHHERDRKSEHNKSSSKDSKRHSGDQ-KSHKRARDESRENDR 774 HHK HH +H+ KD K H+ DQ K HK +D ++++ + Sbjct: 10 HHKKGHHR-----DHHHKDHKDQKDHAKDQSKDHKDQKDHAKDHSK 50 Score = 33.5 bits (73), Expect = 0.46 Identities = 19/48 (39%), Positives = 26/48 (54%), Gaps = 2/48 (4%) Frame = +1 Query: 637 KHHKSSHHERDRKSE--HNKSSSKDSKRHSGDQKSHKRARDESRENDR 774 K H HH +D K + H K SKD K DQK H A+D S+++ + Sbjct: 13 KGHHRDHHHKDHKDQKDHAKDQSKDHK----DQKDH--AKDHSKDHPK 54 >SB_10182| Best HMM Match : Transformer (HMM E-Value=9.9) Length = 245 Score = 37.9 bits (84), Expect = 0.021 Identities = 19/46 (41%), Positives = 25/46 (54%) Frame = +1 Query: 637 KHHKSSHHERDRKSEHNKSSSKDSKRHSGDQKSHKRARDESRENDR 774 K KSS ++ +RKSE K KD + D+ H R RD R +DR Sbjct: 66 KKKKSSKNDDNRKSEKEKYKEKDQRSRERDEDGH-RKRDRDRRDDR 110 Score = 30.7 bits (66), Expect = 3.2 Identities = 15/42 (35%), Positives = 20/42 (47%) Frame = +1 Query: 637 KHHKSSHHERDRKSEHNKSSSKDSKRHSGDQKSHKRARDESR 762 K + +RDR+ E N+ KD H GD+K R E R Sbjct: 101 KRDRDRRDDRDRRGERNRDKDKD---HRGDRKRSDDDRQEKR 139 >SB_5523| Best HMM Match : Extensin_2 (HMM E-Value=0.0052) Length = 532 Score = 37.9 bits (84), Expect = 0.021 Identities = 27/93 (29%), Positives = 45/93 (48%), Gaps = 10/93 (10%) Frame = -3 Query: 340 PTSPYRILHLLLHYPQTHPTH---LTPRNRNRNRH-RILPPFPHQSVR------MRHLLL 191 P ++ H++L P H T+ LTP ++N+N H + PP HQ+ +HL Sbjct: 391 PPHKHQTYHVMLTQPSKHLTYHVTLTPPSKNQNYHVTLTPPHKHQTYHSMLTPPRKHLTY 450 Query: 190 QILRPADRFQHRTRDLGRTSPRFQRTLRYHXVM 92 + R +H+T + T PR + L YH ++ Sbjct: 451 HVTLTPPR-KHQTYHVTLTPPR--KHLTYHSML 480 >SB_4199| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 37.5 bits (83), Expect = 0.028 Identities = 18/49 (36%), Positives = 32/49 (65%), Gaps = 4/49 (8%) Frame = +1 Query: 643 HKSSHHERDR-KSEHNKSSSKDSKRHS---GDQKSHKRARDESRENDRS 777 HK+S HER R ++ ++SS ++ RH + H+R+R E+R+++RS Sbjct: 29 HKTSRHERSRHETSRHESSPHETSRHETSRHETSRHERSRHETRQHERS 77 Score = 31.9 bits (69), Expect = 1.4 Identities = 18/49 (36%), Positives = 29/49 (59%) Frame = +1 Query: 631 RDKHHKSSHHERDRKSEHNKSSSKDSKRHSGDQKSHKRARDESRENDRS 777 + H+SS H + S H +S K S RH + H+R+R E+R+++RS Sbjct: 80 KTSRHESSRH---KTSRHGRSRHKTS-RH--ETSRHERSRHETRQHERS 122 Score = 31.5 bits (68), Expect = 1.8 Identities = 16/53 (30%), Positives = 29/53 (54%), Gaps = 4/53 (7%) Frame = +1 Query: 631 RDKHHKSSHHERDR-KSEHNKSSSKDSKRHS---GDQKSHKRARDESRENDRS 777 + K H++S HER R +S +K+S + RH + H+ +R E+ ++ S Sbjct: 10 KTKQHETSRHERSRHESNRHKTSRHERSRHETSRHESSPHETSRHETSRHETS 62 Score = 31.1 bits (67), Expect = 2.4 Identities = 14/46 (30%), Positives = 29/46 (63%), Gaps = 1/46 (2%) Frame = +1 Query: 643 HKSSHHERDR-KSEHNKSSSKDSKRHSGDQKSHKRARDESRENDRS 777 HK+S H R R K+ +++S + RH + + H+R+R ++ +++S Sbjct: 89 HKTSRHGRSRHKTSRHETSRHERSRH--ETRQHERSRHKTSRHEKS 132 Score = 29.9 bits (64), Expect = 5.6 Identities = 13/45 (28%), Positives = 25/45 (55%) Frame = +1 Query: 643 HKSSHHERDRKSEHNKSSSKDSKRHSGDQKSHKRARDESRENDRS 777 HK+S HE R E ++ ++ +R H+++R E+ ++RS Sbjct: 99 HKTSRHETSR-HERSRHETRQHERSRHKTSRHEKSRHETSRHERS 142 >SB_59404| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 74 Score = 37.1 bits (82), Expect = 0.037 Identities = 18/41 (43%), Positives = 22/41 (53%) Frame = +1 Query: 655 HHERDRKSEHNKSSSKDSKRHSGDQKSHKRARDESRENDRS 777 H E+DR E K KD KR D + KR RD R++D S Sbjct: 7 HKEKDRDRERRKEREKDEKRRDKD-RHRKRDRDRQRDSDDS 46 Score = 30.7 bits (66), Expect = 3.2 Identities = 16/50 (32%), Positives = 24/50 (48%), Gaps = 2/50 (4%) Frame = +1 Query: 637 KHHKSSHHERDRKSEHNKSSSK-DSKRHSGDQKSHKRARDES-RENDRSS 780 K HK +R+R+ E K + D RH + +R D+S R+ R S Sbjct: 5 KKHKEKDRDRERRKEREKDEKRRDKDRHRKRDRDRQRDSDDSERKKKRGS 54 >SB_23345| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 903 Score = 36.7 bits (81), Expect = 0.049 Identities = 13/48 (27%), Positives = 24/48 (50%) Frame = +1 Query: 631 RDKHHKSSHHERDRKSEHNKSSSKDSKRHSGDQKSHKRARDESRENDR 774 +DK HK HH++ R S++ + K + +K + DE +E + Sbjct: 390 KDKEHKEHHHKKKRSHSKTSSTTDEEKERKKSETKNKDSEDEEKERKK 437 Score = 34.3 bits (75), Expect = 0.26 Identities = 14/47 (29%), Positives = 24/47 (51%) Frame = +1 Query: 631 RDKHHKSSHHERDRKSEHNKSSSKDSKRHSGDQKSHKRARDESREND 771 + KHHK H +++ K H+K SK S + +R + E++ D Sbjct: 382 KKKHHKK-HKDKEHKEHHHKKKRSHSKTSSTTDEEKERKKSETKNKD 427 >SB_28630| Best HMM Match : DUF1665 (HMM E-Value=3.4) Length = 428 Score = 36.3 bits (80), Expect = 0.065 Identities = 20/46 (43%), Positives = 25/46 (54%), Gaps = 2/46 (4%) Frame = +1 Query: 649 SSHHERDRKSEHNKSSSKDSKRHSGDQKSHKR--ARDESRENDRSS 780 SS H R +KS ++ S+ S S + HKR RD SR DRSS Sbjct: 263 SSPHSRKKKSRKHRHRSRSSSLSSRRRSKHKRKSKRDRSRSRDRSS 308 Score = 29.5 bits (63), Expect = 7.4 Identities = 18/50 (36%), Positives = 24/50 (48%), Gaps = 1/50 (2%) Frame = +1 Query: 631 RDKHHKSSHHERDRKSEHNKSSSKDSKRHSGDQKSHKRAR-DESRENDRS 777 R KH + S +RDR ++SSSK + S R+R E R RS Sbjct: 289 RSKHKRKS--KRDRSRSRDRSSSKSKSLRRSKKYSRSRSRSSERRRRSRS 336 >SB_22653| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 737 Score = 35.9 bits (79), Expect = 0.085 Identities = 15/49 (30%), Positives = 24/49 (48%) Frame = +1 Query: 631 RDKHHKSSHHERDRKSEHNKSSSKDSKRHSGDQKSHKRARDESRENDRS 777 R + + ++ K E ++ SKD K+ K + +D SRE DRS Sbjct: 216 RKREKEEKKRDKSEKRERSRERSKDRKKDRDSSKHRDKEKDRSRERDRS 264 Score = 33.9 bits (74), Expect = 0.34 Identities = 17/51 (33%), Positives = 24/51 (47%), Gaps = 4/51 (7%) Frame = +1 Query: 637 KHHKSSHHERDRKSEHNKSSSKDSKRHSGDQKSHKRARDES----RENDRS 777 K KS ER R+ ++ +DS +H +K R RD S R DR+ Sbjct: 224 KRDKSEKRERSRERSKDRKKDRDSSKHRDKEKDRSRERDRSGSKHRSKDRT 274 >SB_910| Best HMM Match : Cation_efflux (HMM E-Value=0.056) Length = 416 Score = 35.1 bits (77), Expect = 0.15 Identities = 16/46 (34%), Positives = 26/46 (56%) Frame = +1 Query: 631 RDKHHKSSHHERDRKSEHNKSSSKDSKRHSGDQKSHKRARDESREN 768 RD+ K+ +R+R+ +H S +D R S D+K KR D R++ Sbjct: 326 RDRD-KARDRDRERRDKHKSSRDRDKDRSSRDRKREKRDGDRQRDD 370 Score = 31.5 bits (68), Expect = 1.8 Identities = 15/45 (33%), Positives = 20/45 (44%) Frame = +1 Query: 631 RDKHHKSSHHERDRKSEHNKSSSKDSKRHSGDQKSHKRARDESRE 765 RDKH S ++DR S K +D R D K + + RE Sbjct: 339 RDKHKSSRDRDKDRSSRDRKREKRDGDRQR-DDKDRRDRKHRKRE 382 Score = 31.1 bits (67), Expect = 2.4 Identities = 16/50 (32%), Positives = 25/50 (50%) Frame = +1 Query: 631 RDKHHKSSHHERDRKSEHNKSSSKDSKRHSGDQKSHKRARDESRENDRSS 780 R+K + +RDR + ++ K R + HK +RD R+ DRSS Sbjct: 307 REKERDRNKEDRDRVKDRDRDRDKARDRDRERRDKHKSSRD--RDKDRSS 354 >SB_22966| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 323 Score = 34.7 bits (76), Expect = 0.20 Identities = 14/49 (28%), Positives = 27/49 (55%) Frame = +1 Query: 631 RDKHHKSSHHERDRKSEHNKSSSKDSKRHSGDQKSHKRARDESRENDRS 777 ++K H S+H + D +N SS+ D+ + + +K+ R +NDR+ Sbjct: 262 KNKKHSSNHEKNDININNNSSSNNDNGSNINNNIKNKKHRSNHEKNDRN 310 Score = 29.5 bits (63), Expect = 7.4 Identities = 10/27 (37%), Positives = 18/27 (66%) Frame = +1 Query: 631 RDKHHKSSHHERDRKSEHNKSSSKDSK 711 ++K H+S+H + DR +N SS+ D + Sbjct: 296 KNKKHRSNHEKNDRNINNNSSSNNDKE 322 >SB_621| Best HMM Match : SNF2_N (HMM E-Value=0) Length = 1432 Score = 34.3 bits (75), Expect = 0.26 Identities = 14/47 (29%), Positives = 25/47 (53%) Frame = +1 Query: 631 RDKHHKSSHHERDRKSEHNKSSSKDSKRHSGDQKSHKRARDESREND 771 +D H ++ER+R + ++ +D S +SH+R+ D SR D Sbjct: 1302 KDGHDDRRYYERERDRDRDRDRDRDRYHGSEHPRSHERSSDYSRSKD 1348 >SB_10690| Best HMM Match : Pkinase (HMM E-Value=6.4e-08) Length = 865 Score = 33.9 bits (74), Expect = 0.34 Identities = 16/50 (32%), Positives = 24/50 (48%) Frame = +1 Query: 631 RDKHHKSSHHERDRKSEHNKSSSKDSKRHSGDQKSHKRARDESRENDRSS 780 R++ + SSHH + + KSS S R S + K R S+ +R S Sbjct: 272 RERRNSSSHHRSSSREKDRKSSMDKSIRSSSRDRDKKSRRSWSKSKERDS 321 Score = 33.1 bits (72), Expect = 0.60 Identities = 18/45 (40%), Positives = 25/45 (55%) Frame = +1 Query: 646 KSSHHERDRKSEHNKSSSKDSKRHSGDQKSHKRARDESRENDRSS 780 KS+ ER S H++SSS++ R S KS R SR+ D+ S Sbjct: 268 KSTPRERRNSSSHHRSSSREKDRKSSMDKS---IRSSSRDRDKKS 309 Score = 29.5 bits (63), Expect = 7.4 Identities = 12/49 (24%), Positives = 24/49 (48%) Frame = +1 Query: 631 RDKHHKSSHHERDRKSEHNKSSSKDSKRHSGDQKSHKRARDESRENDRS 777 +D+ + R+ S H SS + ++ S D+ +RD +++ RS Sbjct: 264 KDQEKSTPRERRNSSSHHRSSSREKDRKSSMDKSIRSSSRDRDKKSRRS 312 >SB_31213| Best HMM Match : SNF2_N (HMM E-Value=0) Length = 919 Score = 33.9 bits (74), Expect = 0.34 Identities = 17/45 (37%), Positives = 22/45 (48%) Frame = +1 Query: 631 RDKHHKSSHHERDRKSEHNKSSSKDSKRHSGDQKSHKRARDESRE 765 +D+HH HH R +H SS HS + S +RA D S E Sbjct: 432 QDQHHHHHHHHHHRHHKHRSSSG-----HSTTEASGRRASDHSHE 471 >SB_26185| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 682 Score = 33.9 bits (74), Expect = 0.34 Identities = 16/48 (33%), Positives = 26/48 (54%) Frame = +1 Query: 631 RDKHHKSSHHERDRKSEHNKSSSKDSKRHSGDQKSHKRARDESRENDR 774 R++ K ++DR+ + SSS++SKR ++ KR R RE R Sbjct: 233 REEEKKDRDKDKDRE-DRKSSSSRESKRERRSEEREKRPRSRERERSR 279 >SB_48197| Best HMM Match : Neuromodulin (HMM E-Value=2.5) Length = 394 Score = 33.5 bits (73), Expect = 0.46 Identities = 17/36 (47%), Positives = 20/36 (55%), Gaps = 2/36 (5%) Frame = +1 Query: 646 KSSHHE--RDRKSEHNKSSSKDSKRHSGDQKSHKRA 747 KSS HE D + K SSKD K+H D+K K A Sbjct: 8 KSSKHEGKEDEEKHKAKKSSKDEKKHKKDKKKEKAA 43 >SB_40651| Best HMM Match : Neuromodulin (HMM E-Value=1.2) Length = 1156 Score = 33.5 bits (73), Expect = 0.46 Identities = 17/36 (47%), Positives = 20/36 (55%), Gaps = 2/36 (5%) Frame = +1 Query: 646 KSSHHE--RDRKSEHNKSSSKDSKRHSGDQKSHKRA 747 KSS HE D + K SSKD K+H D+K K A Sbjct: 8 KSSKHEGKEDEEKHKAKKSSKDEKKHKKDKKKEKAA 43 >SB_27558| Best HMM Match : dsrm (HMM E-Value=9.6e-18) Length = 765 Score = 33.5 bits (73), Expect = 0.46 Identities = 14/37 (37%), Positives = 19/37 (51%) Frame = +1 Query: 667 DRKSEHNKSSSKDSKRHSGDQKSHKRARDESRENDRS 777 +R KSS K +HS +K HK+ R SR +S Sbjct: 31 ERSERRGKSSKKHKHKHSKSKKKHKKRRHRSRTRSKS 67 Score = 29.5 bits (63), Expect = 7.4 Identities = 15/46 (32%), Positives = 23/46 (50%), Gaps = 2/46 (4%) Frame = +1 Query: 646 KSSHHERDRKSEHNKSSS--KDSKRHSGDQKSHKRARDESRENDRS 777 K+ E+DRKS + S+ K R +SH+++R S RS Sbjct: 191 KAQDTEKDRKSSRSPSTDKRKSRSRSRSRSRSHRKSRKRSESRSRS 236 >SB_17956| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1449 Score = 33.5 bits (73), Expect = 0.46 Identities = 15/39 (38%), Positives = 25/39 (64%), Gaps = 2/39 (5%) Frame = +1 Query: 664 RDRKSEHNKSS--SKDSKRHSGDQKSHKRARDESRENDR 774 ++RKS H+KSS + SK H D+K KR+ ++ R+ + Sbjct: 1173 KERKSHHDKSSGGKQKSKEHRKDKKKKKRSEEKERKKHK 1211 Score = 29.9 bits (64), Expect = 5.6 Identities = 11/37 (29%), Positives = 16/37 (43%) Frame = +1 Query: 631 RDKHHKSSHHERDRKSEHNKSSSKDSKRHSGDQKSHK 741 R HH S + + EH K K + ++K HK Sbjct: 1175 RKSHHDKSSGGKQKSKEHRKDKKKKKRSEEKERKKHK 1211 >SB_3059| Best HMM Match : REJ (HMM E-Value=4.8e-06) Length = 2009 Score = 33.5 bits (73), Expect = 0.46 Identities = 26/77 (33%), Positives = 31/77 (40%), Gaps = 5/77 (6%) Frame = -3 Query: 328 YRILHLLLHYPQTHP-----THLTPRNRNRNRHRILPPFPHQSVRMRHLLLQILRPADRF 164 Y I H LH P T P ++ T R RHR+ P PH R +R Sbjct: 844 YPIRHRALHLPHTPPCASSTSYATTRCIYLIRHRV-PHLPHTPPRSASSPYATVRYIHPI 902 Query: 163 QHRTRDLGRTSPRFQRT 113 +HRT L T PR T Sbjct: 903 RHRTLHLPHTPPRAAST 919 >SB_25447| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 752 Score = 33.1 bits (72), Expect = 0.60 Identities = 15/38 (39%), Positives = 25/38 (65%) Frame = +1 Query: 661 ERDRKSEHNKSSSKDSKRHSGDQKSHKRARDESRENDR 774 ER R+SE + S ++S+R + ++RAR +RE+DR Sbjct: 201 ERPRESERVRESPRESERVRKSPRGYERARKGTRESDR 238 >SB_9795| Best HMM Match : FF (HMM E-Value=2.3e-33) Length = 693 Score = 33.1 bits (72), Expect = 0.60 Identities = 15/50 (30%), Positives = 26/50 (52%) Frame = +1 Query: 631 RDKHHKSSHHERDRKSEHNKSSSKDSKRHSGDQKSHKRARDESRENDRSS 780 R+K K ER+++ E + +D + S ++ HKR+R SR +S Sbjct: 642 REKE-KEKEKEREKEKEREREKERDRDKSSHKKRRHKRSRSRSRSASTAS 690 Score = 29.5 bits (63), Expect = 7.4 Identities = 11/48 (22%), Positives = 24/48 (50%) Frame = +1 Query: 631 RDKHHKSSHHERDRKSEHNKSSSKDSKRHSGDQKSHKRARDESRENDR 774 +++ + ERD++ E K K+ ++ ++ +R RD+S R Sbjct: 627 KEREKEKEKEERDKEREKEKEKEKEREKEKEREREKERDRDKSSHKKR 674 >SB_48206| Best HMM Match : LTXXQ (HMM E-Value=3) Length = 513 Score = 32.7 bits (71), Expect = 0.80 Identities = 15/48 (31%), Positives = 26/48 (54%) Frame = +2 Query: 593 RAHQRTVAVLPRTEINTISRLTMNAIGRANTTSPQAKTRRDTPAIRSP 736 + QR +A ++N +S + N + + N P+AKTR + P + SP Sbjct: 443 QTRQRLLANATPEQVNALSEIAKNLL-KGNLNVPRAKTRAEQPVLPSP 489 >SB_29377| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 548 Score = 32.7 bits (71), Expect = 0.80 Identities = 14/46 (30%), Positives = 21/46 (45%) Frame = +1 Query: 637 KHHKSSHHERDRKSEHNKSSSKDSKRHSGDQKSHKRARDESRENDR 774 + K ERDR + +K +D R + R RD+ R+ DR Sbjct: 385 EREKDRDKERDRDKDRDKERDRDKDRDKERDRDRDRDRDKERDKDR 430 Score = 31.9 bits (69), Expect = 1.4 Identities = 13/48 (27%), Positives = 25/48 (52%) Frame = +1 Query: 631 RDKHHKSSHHERDRKSEHNKSSSKDSKRHSGDQKSHKRARDESRENDR 774 RDK + ERDR+ + + +D +R + ++ RD+ R+ D+ Sbjct: 352 RDKD-RDRDKERDREKDRERDKDRDKERDRDKDREREKDRDKERDRDK 398 Score = 31.1 bits (67), Expect = 2.4 Identities = 12/43 (27%), Positives = 21/43 (48%) Frame = +1 Query: 646 KSSHHERDRKSEHNKSSSKDSKRHSGDQKSHKRARDESRENDR 774 K ERDR + + +D +R + +R RD+ R+ +R Sbjct: 372 KDRDKERDRDKDREREKDRDKERDRDKDRDKERDRDKDRDKER 414 Score = 30.7 bits (66), Expect = 3.2 Identities = 13/49 (26%), Positives = 25/49 (51%), Gaps = 1/49 (2%) Frame = +1 Query: 631 RDKHH-KSSHHERDRKSEHNKSSSKDSKRHSGDQKSHKRARDESRENDR 774 RDK K ++DR+ E ++ +D + ++ + RD+ R+ DR Sbjct: 370 RDKDRDKERDRDKDREREKDRDKERDRDKDRDKERDRDKDRDKERDRDR 418 Score = 30.3 bits (65), Expect = 4.2 Identities = 11/48 (22%), Positives = 22/48 (45%) Frame = +1 Query: 631 RDKHHKSSHHERDRKSEHNKSSSKDSKRHSGDQKSHKRARDESRENDR 774 +DK + +DR + + +D + +K +R +D +E DR Sbjct: 333 KDKKDRDRGRNKDRDRDKERDKDRDRDKERDREKDRERDKDRDKERDR 380 Score = 30.3 bits (65), Expect = 4.2 Identities = 11/43 (25%), Positives = 22/43 (51%) Frame = +1 Query: 646 KSSHHERDRKSEHNKSSSKDSKRHSGDQKSHKRARDESRENDR 774 + + +RDR E +K +D +R + + RD+ R+ D+ Sbjct: 340 RGRNKDRDRDKERDKDRDRDKERDREKDRERDKDRDKERDRDK 382 Score = 29.9 bits (64), Expect = 5.6 Identities = 13/48 (27%), Positives = 24/48 (50%) Frame = +1 Query: 631 RDKHHKSSHHERDRKSEHNKSSSKDSKRHSGDQKSHKRARDESRENDR 774 RDK + +R+R + +K +D R + +R RD+ R+ +R Sbjct: 358 RDKE-RDREKDRERDKDRDKERDRDKDREREKDRDKERDRDKDRDKER 404 Score = 29.9 bits (64), Expect = 5.6 Identities = 11/43 (25%), Positives = 20/43 (46%) Frame = +1 Query: 646 KSSHHERDRKSEHNKSSSKDSKRHSGDQKSHKRARDESRENDR 774 K ++DR E ++ +D +R + + RD+ R DR Sbjct: 392 KERDRDKDRDKERDRDKDRDKERDRDRDRDRDKERDKDRHRDR 434 >SB_24438| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 32.7 bits (71), Expect = 0.80 Identities = 15/46 (32%), Positives = 29/46 (63%), Gaps = 1/46 (2%) Frame = +1 Query: 643 HKSSHHERDR-KSEHNKSSSKDSKRHSGDQKSHKRARDESRENDRS 777 HK+S HER R K+ +++S + RH + + H+R+R ++ ++ S Sbjct: 49 HKTSRHERSRHKTSRHETSRHERSRH--ETRQHERSRHKTSRHETS 92 Score = 31.9 bits (69), Expect = 1.4 Identities = 18/49 (36%), Positives = 29/49 (59%) Frame = +1 Query: 631 RDKHHKSSHHERDRKSEHNKSSSKDSKRHSGDQKSHKRARDESRENDRS 777 + H+SS H + S H +S K S RH + H+R+R E+R+++RS Sbjct: 40 KTSRHESSRH---KTSRHERSRHKTS-RH--ETSRHERSRHETRQHERS 82 >SB_26314| Best HMM Match : SURF6 (HMM E-Value=2.8) Length = 222 Score = 32.3 bits (70), Expect = 1.1 Identities = 17/52 (32%), Positives = 28/52 (53%), Gaps = 7/52 (13%) Frame = +1 Query: 634 DKHHKSS--HHERDRKS--EHNKSSSKDSKRHSGDQKSH---KRARDESREN 768 +K+H +H++D K E K+ +D K H D+K+H ++ DE EN Sbjct: 52 EKNHDEDEKNHDKDEKKHDEDEKNHDEDEKNHDEDEKNHDEDEKNHDEDEEN 103 Score = 31.9 bits (69), Expect = 1.4 Identities = 15/43 (34%), Positives = 25/43 (58%), Gaps = 5/43 (11%) Frame = +1 Query: 655 HHERDRKS--EHNKSSSKDSKRHSGDQKSH---KRARDESREN 768 +H+ D K+ E K+ KD K+H D+K+H ++ DE +N Sbjct: 47 NHDEDEKNHDEDEKNHDKDEKKHDEDEKNHDEDEKNHDEDEKN 89 Score = 31.9 bits (69), Expect = 1.4 Identities = 12/48 (25%), Positives = 22/48 (45%) Frame = +1 Query: 634 DKHHKSSHHERDRKSEHNKSSSKDSKRHSGDQKSHKRARDESRENDRS 777 DK K + E K+ +D K H D+K+H + E++++ Sbjct: 63 DKDEKKHDEDEKNHDEDEKNHDEDEKNHDEDEKNHDEDEENHDEDEKN 110 Score = 29.9 bits (64), Expect = 5.6 Identities = 14/49 (28%), Positives = 25/49 (51%), Gaps = 3/49 (6%) Frame = +1 Query: 637 KHHKSS-HHERDRKS--EHNKSSSKDSKRHSGDQKSHKRARDESRENDR 774 KH + +H+ D K+ E K+ +D K H D+++H E+D+ Sbjct: 68 KHDEDEKNHDEDEKNHDEDEKNHDEDEKNHDEDEENHDEDEKNHDEDDK 116 >SB_35523| Best HMM Match : RVT_1 (HMM E-Value=0) Length = 1410 Score = 32.3 bits (70), Expect = 1.1 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = +1 Query: 109 EGFFENGGWSFLDP 150 E F ENGGWSFLDP Sbjct: 1292 EEFLENGGWSFLDP 1305 >SB_9657| Best HMM Match : P_proprotein (HMM E-Value=7.5e-29) Length = 1779 Score = 31.9 bits (69), Expect = 1.4 Identities = 11/44 (25%), Positives = 21/44 (47%) Frame = +1 Query: 637 KHHKSSHHERDRKSEHNKSSSKDSKRHSGDQKSHKRARDESREN 768 KHH++ H+ ++ H++ K H HK + + R+N Sbjct: 339 KHHRNKHYRHHDRNHHHRHHHHHHKHHHKAANHHKLSTQKQRKN 382 >SB_12735| Best HMM Match : PT (HMM E-Value=0.36) Length = 1148 Score = 31.9 bits (69), Expect = 1.4 Identities = 18/49 (36%), Positives = 26/49 (53%) Frame = +1 Query: 634 DKHHKSSHHERDRKSEHNKSSSKDSKRHSGDQKSHKRARDESRENDRSS 780 D KS H + RK + N+S S D S D ++HKR + +ND+ S Sbjct: 761 DAKQKSVHQSQQRK-QMNRSRS-DRSLGSTDDRTHKRLKTVDEQNDQPS 807 >SB_10489| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 185 Score = 31.5 bits (68), Expect = 1.8 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = -3 Query: 364 PRPLLVPDPTSPYRILHLLLHYPQTHPT 281 P P++ P T Y +LHL LH P PT Sbjct: 114 PTPIVTPSYTYTYTLLHLYLHPPTPIPT 141 Score = 29.5 bits (63), Expect = 7.4 Identities = 20/62 (32%), Positives = 24/62 (38%), Gaps = 2/62 (3%) Frame = -3 Query: 364 PRPLLVPDPTSPYRILHLLLHYPQTHPTHLTPRNRNRNRHRILP--PFPHQSVRMRHLLL 191 P P+ P T Y +LHL LH P T + P P P S RH LL Sbjct: 26 PTPIATPSYTYTYTLLHLYLHPPTPIGTPSYTYTYTLLHIYLHPPTPIPTPSYTYRHTLL 85 Query: 190 QI 185 + Sbjct: 86 HL 87 Score = 29.1 bits (62), Expect = 9.8 Identities = 20/62 (32%), Positives = 28/62 (45%), Gaps = 2/62 (3%) Frame = -3 Query: 364 PRPLLVPDPTSPYRILHLLLHYPQTHPT-HLTPRNRNRNRHRILP-PFPHQSVRMRHLLL 191 P P+ P T Y +LH+ LH P PT T R+ + + P P P S + LL Sbjct: 48 PTPIGTPSYTYTYTLLHIYLHPPTPIPTPSYTYRHTLLHLYTHPPTPIPTPSYTYTYTLL 107 Query: 190 QI 185 + Sbjct: 108 HL 109 >SB_45809| Best HMM Match : Vicilin_N (HMM E-Value=4.5) Length = 215 Score = 31.5 bits (68), Expect = 1.8 Identities = 15/44 (34%), Positives = 23/44 (52%) Frame = +1 Query: 649 SSHHERDRKSEHNKSSSKDSKRHSGDQKSHKRARDESRENDRSS 780 SS + DR+ + + SSK R S + +R R +SR+ D S Sbjct: 5 SSDSDDDRRRKRSSKSSKKRDRRSRSRSRERRRRSKSRDRDSRS 48 Score = 29.9 bits (64), Expect = 5.6 Identities = 15/49 (30%), Positives = 27/49 (55%) Frame = +1 Query: 631 RDKHHKSSHHERDRKSEHNKSSSKDSKRHSGDQKSHKRARDESRENDRS 777 RD+ +S ER R+S KS +DS+ + ++ + + R++DRS Sbjct: 24 RDRRSRSRSRERRRRS---KSRDRDSRSRTSSRRRSRSSERRHRKDDRS 69 >SB_23985| Best HMM Match : CRAM_rpt (HMM E-Value=3.4) Length = 323 Score = 31.5 bits (68), Expect = 1.8 Identities = 14/51 (27%), Positives = 25/51 (49%), Gaps = 2/51 (3%) Frame = +1 Query: 634 DKHHKSSHHERDRKSEHNKSSSKDSKRHS--GDQKSHKRARDESRENDRSS 780 + + +E D+ +E +KS+ D + S D+ DES E+D S+ Sbjct: 121 ESNESDKSNESDKSNESDKSNESDKRNESDESDEDDESNGSDESNESDESN 171 >SB_22497| Best HMM Match : Ras (HMM E-Value=7.7e-07) Length = 769 Score = 31.5 bits (68), Expect = 1.8 Identities = 11/49 (22%), Positives = 24/49 (48%) Frame = +1 Query: 634 DKHHKSSHHERDRKSEHNKSSSKDSKRHSGDQKSHKRARDESRENDRSS 780 +K S H++ + E +K + + + K H+++RDE + + S Sbjct: 697 EKPKSKSKHKKSKDKEEHKEKRRSRHKDNDSAKEHRKSRDEEGDKKKKS 745 Score = 30.7 bits (66), Expect = 3.2 Identities = 16/49 (32%), Positives = 26/49 (53%) Frame = +1 Query: 631 RDKHHKSSHHERDRKSEHNKSSSKDSKRHSGDQKSHKRARDESRENDRS 777 R K HKS + KS+H SKD + H ++S + D ++E+ +S Sbjct: 689 RHKEHKSGEKPKS-KSKH--KKSKDKEEHKEKRRSRHKDNDSAKEHRKS 734 >SB_21715| Best HMM Match : Serglycin (HMM E-Value=0.054) Length = 1079 Score = 31.5 bits (68), Expect = 1.8 Identities = 11/41 (26%), Positives = 24/41 (58%) Frame = +1 Query: 640 HHKSSHHERDRKSEHNKSSSKDSKRHSGDQKSHKRARDESR 762 HH+ H++++RK +K + +RHS + H++ D+ + Sbjct: 752 HHRRRHNKKNRKHRKSKKNKNHRRRHSAHE--HRKDNDKEK 790 Score = 30.3 bits (65), Expect = 4.2 Identities = 12/41 (29%), Positives = 21/41 (51%) Frame = +1 Query: 631 RDKHHKSSHHERDRKSEHNKSSSKDSKRHSGDQKSHKRARD 753 +D+H + H R ++H K S + S+R Q+ H + D Sbjct: 833 QDRHRRHHHRRRHHNNKHRKHSREHSRRR--HQRKHHKGND 871 Score = 29.1 bits (62), Expect = 9.8 Identities = 11/47 (23%), Positives = 20/47 (42%) Frame = +1 Query: 631 RDKHHKSSHHERDRKSEHNKSSSKDSKRHSGDQKSHKRARDESREND 771 + +HH HH R +K ++++ +H K H + ND Sbjct: 644 KHRHHHHHHHHRSKKDRRHRNTKTHHAKH---LKGHSARKHRKENND 687 >SB_12617| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 31.5 bits (68), Expect = 1.8 Identities = 11/49 (22%), Positives = 24/49 (48%) Frame = +1 Query: 634 DKHHKSSHHERDRKSEHNKSSSKDSKRHSGDQKSHKRARDESRENDRSS 780 +K S H++ + E +K + + + K H+++RDE + + S Sbjct: 65 EKPKSKSKHKKSKDKEEHKEKRRSRHKDNDSAKEHRKSRDEEGDKKKKS 113 Score = 30.7 bits (66), Expect = 3.2 Identities = 16/49 (32%), Positives = 26/49 (53%) Frame = +1 Query: 631 RDKHHKSSHHERDRKSEHNKSSSKDSKRHSGDQKSHKRARDESRENDRS 777 R K HKS + KS+H SKD + H ++S + D ++E+ +S Sbjct: 57 RHKEHKSGEKPKS-KSKH--KKSKDKEEHKEKRRSRHKDNDSAKEHRKS 102 >SB_53468| Best HMM Match : E-MAP-115 (HMM E-Value=4.2) Length = 583 Score = 31.1 bits (67), Expect = 2.4 Identities = 13/47 (27%), Positives = 23/47 (48%) Frame = +1 Query: 640 HHKSSHHERDRKSEHNKSSSKDSKRHSGDQKSHKRARDESRENDRSS 780 H K H ER K + S + + H +++SH+ +E R ++ S Sbjct: 452 HEKRPHEERSHKERSQEKRSHEKRPH--EERSHEERSEEERTHEERS 496 >SB_49989| Best HMM Match : GRP (HMM E-Value=2.3) Length = 181 Score = 31.1 bits (67), Expect = 2.4 Identities = 13/47 (27%), Positives = 24/47 (51%), Gaps = 2/47 (4%) Frame = +1 Query: 646 KSSHHERDRKSEHNKSSSKDSKRH--SGDQKSHKRARDESRENDRSS 780 K H E + +H++ S + + H SG K H R +++++ R S Sbjct: 61 KQHHRESGQAKQHHRGSGQAKQHHRGSGQAKQHHRGSGQAKQHHRGS 107 >SB_39433| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1291 Score = 31.1 bits (67), Expect = 2.4 Identities = 14/49 (28%), Positives = 20/49 (40%) Frame = +1 Query: 631 RDKHHKSSHHERDRKSEHNKSSSKDSKRHSGDQKSHKRARDESRENDRS 777 RD+ RDR ++S +D +RH + RD RE S Sbjct: 429 RDRDRGRDRRRRDRSRSRDRSRDRDRRRHRDRSRERGGGRDRYRERSPS 477 >SB_33470| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 328 Score = 31.1 bits (67), Expect = 2.4 Identities = 16/50 (32%), Positives = 22/50 (44%), Gaps = 2/50 (4%) Frame = +1 Query: 631 RDKHHKSSHHERD--RKSEHNKSSSKDSKRHSGDQKSHKRARDESRENDR 774 R K + H+ERD +++ +DS R S K H R E DR Sbjct: 191 RQKEERERHNERDEWKRAGGEHRGRRDSNRSSDGDKQHPRRDSEKSTEDR 240 >SB_6619| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 942 Score = 31.1 bits (67), Expect = 2.4 Identities = 16/48 (33%), Positives = 24/48 (50%) Frame = +1 Query: 631 RDKHHKSSHHERDRKSEHNKSSSKDSKRHSGDQKSHKRARDESRENDR 774 +D + S D SE K K K+HS D+K K +++ RE D+ Sbjct: 138 KDSNEGSLTISNDLNSE--KKDKKKHKKHSKDKKKKKHKKEKKREKDK 183 >SB_35177| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1293 Score = 30.7 bits (66), Expect = 3.2 Identities = 15/45 (33%), Positives = 22/45 (48%) Frame = +1 Query: 646 KSSHHERDRKSEHNKSSSKDSKRHSGDQKSHKRARDESRENDRSS 780 K S +D S H+ + S D + ++R R SRE+DR S Sbjct: 864 KKSSDRKDPLSRHHTEERRGSVGSKADIEDNRRKRSSSRESDRYS 908 >SB_8346| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 30.7 bits (66), Expect = 3.2 Identities = 13/52 (25%), Positives = 26/52 (50%), Gaps = 3/52 (5%) Frame = +1 Query: 631 RDKHHKSSHHERDR---KSEHNKSSSKDSKRHSGDQKSHKRARDESRENDRS 777 +DK +++ +E+ K + K+ K+ KRH G K + + EN+ + Sbjct: 22 KDKQEENARNEKKETKHKKQQEKNEKKEEKRHEGGNKQEENEDEGEDENEET 73 >SB_41631| Best HMM Match : Ank (HMM E-Value=0.00018) Length = 353 Score = 30.7 bits (66), Expect = 3.2 Identities = 15/48 (31%), Positives = 21/48 (43%) Frame = +1 Query: 634 DKHHKSSHHERDRKSEHNKSSSKDSKRHSGDQKSHKRARDESRENDRS 777 D HH S H + + + K S K+H D++ R RE RS Sbjct: 170 DSHHHSDHRDEESHRDGRKRSKDYEKQHHNDRRL-SREEGSYREGHRS 216 >SB_12670| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1272 Score = 30.7 bits (66), Expect = 3.2 Identities = 10/38 (26%), Positives = 21/38 (55%) Frame = +1 Query: 664 RDRKSEHNKSSSKDSKRHSGDQKSHKRARDESRENDRS 777 +++K +H K S +H K HK+ +++ + +D S Sbjct: 1189 KEKKKKHKKHKKHGSAKHKKKDKKHKKQKEKQKTSDGS 1226 >SB_29507| Best HMM Match : E-MAP-115 (HMM E-Value=5.1) Length = 198 Score = 30.3 bits (65), Expect = 4.2 Identities = 14/62 (22%), Positives = 23/62 (37%) Frame = +1 Query: 631 RDKHHKSSHHERDRKSEHNKSSSKDSKRHSGDQKSHKRARDESRENDRSSXXXXXXXXVE 810 RD+ + S H+RD + + D D K + RD + DR + + Sbjct: 16 RDRRDRDSTHDRDTRDRDEDARDCDRGTPDRDSKCDRDTRDRDSKRDRDTHDRDSTRDED 75 Query: 811 VH 816 H Sbjct: 76 TH 77 >SB_45236| Best HMM Match : PRP38 (HMM E-Value=0) Length = 381 Score = 30.3 bits (65), Expect = 4.2 Identities = 14/48 (29%), Positives = 21/48 (43%) Frame = +1 Query: 631 RDKHHKSSHHERDRKSEHNKSSSKDSKRHSGDQKSHKRARDESRENDR 774 R+ KS +RDR + + +D +R + H R RD R R Sbjct: 268 RNSRDKSRDPDRDRPRDSERDRYRDIERDRHRDRRHSRDRDRKRSRSR 315 Score = 29.9 bits (64), Expect = 5.6 Identities = 14/50 (28%), Positives = 26/50 (52%), Gaps = 2/50 (4%) Frame = +1 Query: 631 RDKHHKSSHHERDRKSEHNKSSSKDSK--RHSGDQKSHKRARDESRENDR 774 R + H S + RD+ + ++ +DS+ R+ ++ R R SR+ DR Sbjct: 260 RSRDHSSRRNSRDKSRDPDRDRPRDSERDRYRDIERDRHRDRRHSRDRDR 309 >SB_47990| Best HMM Match : RRM_1 (HMM E-Value=7.8e-28) Length = 440 Score = 29.9 bits (64), Expect = 5.6 Identities = 16/51 (31%), Positives = 25/51 (49%), Gaps = 4/51 (7%) Frame = +1 Query: 637 KHHKSSHHERDR-KSEHNKSSSKDSKRHSGD---QKSHKRARDESRENDRS 777 +H + S + R R +S H +S S D +KS +++R SR RS Sbjct: 252 RHKERSRYHRSRSRSRHRRSRSNSPSMRKSDRKFKKSQRKSRSRSRNRSRS 302 >SB_28619| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 29.9 bits (64), Expect = 5.6 Identities = 11/40 (27%), Positives = 20/40 (50%) Frame = +1 Query: 655 HHERDRKSEHNKSSSKDSKRHSGDQKSHKRARDESRENDR 774 + ++DR + + ++D R + RARD R+ DR Sbjct: 42 NRDQDRDQDQGRDRARDRDRDRDQDQGRDRARDRDRDRDR 81 >SB_7913| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 336 Score = 29.9 bits (64), Expect = 5.6 Identities = 14/53 (26%), Positives = 26/53 (49%), Gaps = 5/53 (9%) Frame = +1 Query: 637 KHHKSSHHERDRKSEHNKSSSKDSKR-----HSGDQKSHKRARDESRENDRSS 780 + H+S R + H++S S +R HS ++K HK+ + ++ R S Sbjct: 254 RSHRSRSRSRSPRRRHSRSRSPTHRRHRSRSHSPEKKKHKKKEKKEKDEKRKS 306 >SB_21838| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 949 Score = 29.9 bits (64), Expect = 5.6 Identities = 14/44 (31%), Positives = 22/44 (50%) Frame = +1 Query: 646 KSSHHERDRKSEHNKSSSKDSKRHSGDQKSHKRARDESRENDRS 777 +S +ER R +N+ D R + R+RDE R ++RS Sbjct: 248 RSRGYERSRGQNYNRYRDDDRSRDRHLDRPRGRSRDEGRRDERS 291 >SB_20424| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1711 Score = 29.9 bits (64), Expect = 5.6 Identities = 15/49 (30%), Positives = 27/49 (55%) Frame = +1 Query: 631 RDKHHKSSHHERDRKSEHNKSSSKDSKRHSGDQKSHKRARDESRENDRS 777 RD+ +S ER R+S KS +DS+ + ++ + + R++DRS Sbjct: 1594 RDRRSRSRSRERRRRS---KSRDRDSRSRTSSRRRSRSSERRHRKDDRS 1639 Score = 29.1 bits (62), Expect = 9.8 Identities = 13/38 (34%), Positives = 20/38 (52%) Frame = +1 Query: 667 DRKSEHNKSSSKDSKRHSGDQKSHKRARDESRENDRSS 780 DR+ + + SSK R S + +R R +SR+ D S Sbjct: 1581 DRRRKRSSKSSKKRDRRSRSRSRERRRRSKSRDRDSRS 1618 >SB_59216| Best HMM Match : DUF1540 (HMM E-Value=0.25) Length = 230 Score = 29.5 bits (63), Expect = 7.4 Identities = 14/34 (41%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Frame = +1 Query: 673 KSEHNKSSSKDSKRHSGDQKSH-KRARDESREND 771 K +SSS +KR + H +R RDE +END Sbjct: 119 KQREQRSSSATAKRRGNTGRKHTQRPRDERKEND 152 >SB_36660| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1021 Score = 29.5 bits (63), Expect = 7.4 Identities = 14/34 (41%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Frame = +1 Query: 673 KSEHNKSSSKDSKRHSGDQKSH-KRARDESREND 771 K +SSS +KR + H +R RDE +END Sbjct: 345 KQREQRSSSATAKRRGNTGRKHTQRPRDERKEND 378 >SB_39925| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 29.1 bits (62), Expect = 9.8 Identities = 15/44 (34%), Positives = 22/44 (50%) Frame = -3 Query: 340 PTSPYRILHLLLHYPQTHPTHLTPRNRNRNRHRILPPFPHQSVR 209 P++P I H + + T L+P + RH+ PP PH VR Sbjct: 20 PSAPATIPHSTTNTDNSSTTSLSPN--SNIRHQFRPPQPHPQVR 61 >SB_20358| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1323 Score = 29.1 bits (62), Expect = 9.8 Identities = 10/51 (19%), Positives = 31/51 (60%), Gaps = 1/51 (1%) Frame = +1 Query: 631 RDKHHKSSHHERDRKSEHNKSSSKDSKRHS-GDQKSHKRARDESRENDRSS 780 R++ + +++++K + ++SS +S + S ++K+ + + ++ND+ S Sbjct: 254 RERKERKKKNKKEKKHKSKETSSSESNKSSDSEEKAKSKKNKKDKKNDKDS 304 >SB_12780| Best HMM Match : SAC3_GANP (HMM E-Value=3.7e-07) Length = 436 Score = 29.1 bits (62), Expect = 9.8 Identities = 15/44 (34%), Positives = 22/44 (50%) Frame = -3 Query: 340 PTSPYRILHLLLHYPQTHPTHLTPRNRNRNRHRILPPFPHQSVR 209 P++P I H + + T L+P + RH+ PP PH VR Sbjct: 128 PSAPATIPHSTTNTDNSSTTSLSPN--SNIRHQFRPPQPHPQVR 169 >SB_11304| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 420 Score = 29.1 bits (62), Expect = 9.8 Identities = 14/49 (28%), Positives = 24/49 (48%) Frame = +1 Query: 631 RDKHHKSSHHERDRKSEHNKSSSKDSKRHSGDQKSHKRARDESRENDRS 777 R + + +ERD K K +SKR K+ + RD +RE +++ Sbjct: 312 RARTRPTETNERDVKPSGEKRDDGESKRDRDRDKNRDKNRDRNREREKN 360 >SB_3033| Best HMM Match : RRM_1 (HMM E-Value=2.3e-20) Length = 1313 Score = 29.1 bits (62), Expect = 9.8 Identities = 16/41 (39%), Positives = 22/41 (53%) Frame = +2 Query: 80 SNEDHHGMISKGSLKTGAGPS*IPSPMLKTISRTKNLKKKM 202 SNED GS G+GPS SP+ + I+ N K+K+ Sbjct: 801 SNEDEMSRSEPGSPTPGSGPS---SPIRRNINNKPNTKRKV 838 >SB_27758| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1926 Score = 29.1 bits (62), Expect = 9.8 Identities = 12/46 (26%), Positives = 24/46 (52%) Frame = +1 Query: 637 KHHKSSHHERDRKSEHNKSSSKDSKRHSGDQKSHKRARDESRENDR 774 K+ + + R + +SS+ DS++ +G+ KSH+ R D+ Sbjct: 1680 KNLRENEARRSSSPKDKRSSTPDSRKPTGENKSHRNDRRPPTPQDK 1725 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 26,212,104 Number of Sequences: 59808 Number of extensions: 422324 Number of successful extensions: 2278 Number of sequences better than 10.0: 59 Number of HSP's better than 10.0 without gapping: 1707 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2217 length of database: 16,821,457 effective HSP length: 85 effective length of database: 11,737,777 effective search space used: 4953341894 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -