BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030725E6_G02_e495_14.seq (1532 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_11396| Best HMM Match : Ribosomal_S2 (HMM E-Value=0) 234 1e-61 SB_17237| Best HMM Match : No HMM Matches (HMM E-Value=.) 75 2e-13 SB_28519| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 6e-13 SB_3496| Best HMM Match : Herpes_UL49_5 (HMM E-Value=7.2) 73 8e-13 SB_30142| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 1e-12 SB_43825| Best HMM Match : No HMM Matches (HMM E-Value=.) 72 1e-12 SB_17217| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 3e-11 SB_58792| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 4e-11 SB_55579| Best HMM Match : Rhodanese (HMM E-Value=9.2e-29) 67 4e-11 SB_50054| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 4e-11 SB_49806| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 4e-11 SB_47433| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 4e-11 SB_47291| Best HMM Match : PilN (HMM E-Value=0.75) 67 4e-11 SB_45437| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.53) 67 4e-11 SB_42949| Best HMM Match : SRCR (HMM E-Value=1.6e-14) 67 4e-11 SB_40068| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) 67 4e-11 SB_36207| Best HMM Match : 7kD_coat (HMM E-Value=7.6) 67 4e-11 SB_31511| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 4e-11 SB_29521| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 4e-11 SB_27897| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 4e-11 SB_27010| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 4e-11 SB_26995| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 4e-11 SB_20900| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 4e-11 SB_20814| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 4e-11 SB_15447| Best HMM Match : C1_1 (HMM E-Value=0.11) 67 4e-11 SB_14175| Best HMM Match : GBP_repeat (HMM E-Value=3.8) 67 4e-11 SB_8424| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 4e-11 SB_6796| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 4e-11 SB_56358| Best HMM Match : Fork_head (HMM E-Value=1.2e-30) 67 4e-11 SB_56058| Best HMM Match : Phasin (HMM E-Value=2.7) 67 4e-11 SB_52523| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 4e-11 SB_48632| Best HMM Match : DUF265 (HMM E-Value=7.6e-22) 67 4e-11 SB_46830| Best HMM Match : Succ_DH_flav_C (HMM E-Value=3.2e-37) 67 4e-11 SB_42128| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 4e-11 SB_40139| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 4e-11 SB_31293| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 4e-11 SB_30699| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 4e-11 SB_29464| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 4e-11 SB_25673| Best HMM Match : MFS_1 (HMM E-Value=0.18) 67 4e-11 SB_24724| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 4e-11 SB_17049| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 4e-11 SB_12580| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 4e-11 SB_11401| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 4e-11 SB_10689| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 4e-11 SB_9250| Best HMM Match : BAG (HMM E-Value=6.2) 67 4e-11 SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) 66 9e-11 SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) 66 9e-11 SB_4159| Best HMM Match : Vpu (HMM E-Value=2) 66 9e-11 SB_46484| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 1e-10 SB_24487| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 1e-10 SB_17246| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 2e-10 SB_13077| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 3e-10 SB_45641| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 4e-10 SB_32211| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 4e-10 SB_1214| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 4e-10 SB_59802| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_59119| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_58967| Best HMM Match : Sec23_BS (HMM E-Value=5.9) 63 5e-10 SB_58852| Best HMM Match : Hormone_4 (HMM E-Value=2.8) 63 5e-10 SB_58713| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_58195| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_58029| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_56603| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_56369| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_55830| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_54985| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_54503| Best HMM Match : DUF753 (HMM E-Value=4.7) 63 5e-10 SB_53675| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_53669| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_53077| Best HMM Match : SRP54_N (HMM E-Value=1.8) 63 5e-10 SB_52837| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_51967| Best HMM Match : Wzy_C (HMM E-Value=7.3) 63 5e-10 SB_50928| Best HMM Match : 7tm_2 (HMM E-Value=4.7e-07) 63 5e-10 SB_50489| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_50209| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_50159| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_48422| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_47991| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_47859| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_46080| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_45570| Best HMM Match : Euplotes_phero (HMM E-Value=2.6) 63 5e-10 SB_45449| Best HMM Match : Glyco_hydro_47 (HMM E-Value=1.4e-07) 63 5e-10 SB_43819| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_42373| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_42112| Best HMM Match : Herpes_UL49_2 (HMM E-Value=1.5) 63 5e-10 SB_41613| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_41202| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_41136| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_41068| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_40980| Best HMM Match : ANF_receptor (HMM E-Value=0.00014) 63 5e-10 SB_40764| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_40601| Best HMM Match : VWA_CoxE (HMM E-Value=6.3) 63 5e-10 SB_40576| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_40463| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_40182| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_40003| Best HMM Match : YTV (HMM E-Value=8.9) 63 5e-10 SB_39444| Best HMM Match : SAC3_GANP (HMM E-Value=0.68) 63 5e-10 SB_38813| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_38774| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_38425| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_38203| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_37771| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_36681| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_36014| Best HMM Match : DUF437 (HMM E-Value=6.4) 63 5e-10 SB_35849| Best HMM Match : Fibrinogen_C (HMM E-Value=0.15) 63 5e-10 SB_35317| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_35151| Best HMM Match : DUF589 (HMM E-Value=7.5) 63 5e-10 SB_34685| Best HMM Match : RNA_pol_A_bac (HMM E-Value=1.8) 63 5e-10 SB_34478| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_31889| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_29043| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_28650| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_28487| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_28424| Best HMM Match : SAM_1 (HMM E-Value=8e-06) 63 5e-10 SB_28245| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_27137| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_27095| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_26954| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_26672| Best HMM Match : Exo_endo_phos (HMM E-Value=0.46) 63 5e-10 SB_26607| Best HMM Match : K_tetra (HMM E-Value=3.3e-08) 63 5e-10 SB_25727| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_25469| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_25193| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_23294| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_23196| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_23195| Best HMM Match : zf-C3HC4 (HMM E-Value=1.3e-10) 63 5e-10 SB_22108| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_21853| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_21523| Best HMM Match : Pkinase (HMM E-Value=9.5e-14) 63 5e-10 SB_20847| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_20629| Best HMM Match : WD40 (HMM E-Value=0.0014) 63 5e-10 SB_18983| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_18796| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_18538| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_18411| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_18318| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_18158| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_15818| Best HMM Match : Apo-VLDL-II (HMM E-Value=1.2) 63 5e-10 SB_15375| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_14672| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_14518| Best HMM Match : MIB_HERC2 (HMM E-Value=2.4e-38) 63 5e-10 SB_14044| Best HMM Match : EGF_CA (HMM E-Value=4.1e-13) 63 5e-10 SB_13919| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_13475| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_13295| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_13049| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_12559| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_12016| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_11991| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_11294| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_10247| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_9391| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_9055| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_8565| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_8222| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_8126| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_7261| Best HMM Match : RHS (HMM E-Value=5.3) 63 5e-10 SB_7005| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_6339| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_6047| Best HMM Match : CXC (HMM E-Value=7.7) 63 5e-10 SB_5753| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_5503| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_5427| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_4286| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_4268| Best HMM Match : MtrG (HMM E-Value=1.2) 63 5e-10 SB_4192| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_3720| Best HMM Match : RVT_1 (HMM E-Value=0.0031) 63 5e-10 SB_3671| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_2384| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_1609| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_751| Best HMM Match : rve (HMM E-Value=7.5e-12) 63 5e-10 SB_266| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_59| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_58440| Best HMM Match : Ribosomal_L9_C (HMM E-Value=0.81) 63 5e-10 SB_58394| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_57506| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_57021| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_56970| Best HMM Match : Thaumatin (HMM E-Value=5.4) 63 5e-10 SB_56955| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_56767| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_56729| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_56672| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_56555| Best HMM Match : 7tm_1 (HMM E-Value=4.4) 63 5e-10 SB_56099| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_55954| Best HMM Match : TIL (HMM E-Value=0.74) 63 5e-10 SB_55138| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_55112| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_54421| Best HMM Match : HipA_C (HMM E-Value=7.5) 63 5e-10 SB_54343| Best HMM Match : TipAS (HMM E-Value=0.77) 63 5e-10 SB_54153| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_54005| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_53974| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_53662| Best HMM Match : Protamine_P2 (HMM E-Value=9.2) 63 5e-10 SB_53598| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_53044| Best HMM Match : TcpA (HMM E-Value=3.1) 63 5e-10 SB_52956| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_51739| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_51732| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_51109| Best HMM Match : ATP-cone (HMM E-Value=0.76) 63 5e-10 SB_50972| Best HMM Match : MH1 (HMM E-Value=7.1) 63 5e-10 SB_50818| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_50491| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_50286| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_50222| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_50081| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_50019| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_49981| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_49899| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_49895| Best HMM Match : NACHT (HMM E-Value=7.7) 63 5e-10 SB_49629| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_47940| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_47474| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_47304| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_47265| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_47031| Best HMM Match : Protamine_P1 (HMM E-Value=7) 63 5e-10 SB_46118| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_45749| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_45575| Best HMM Match : Keratin_B2 (HMM E-Value=8.8) 63 5e-10 SB_45266| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_44239| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_44171| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_44073| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_43752| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_43722| Best HMM Match : TPR_4 (HMM E-Value=0.69) 63 5e-10 SB_42847| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_42555| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_42300| Best HMM Match : Filament_head (HMM E-Value=4.9) 63 5e-10 SB_42133| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_41545| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_41358| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_41085| Best HMM Match : Auxin_repressed (HMM E-Value=9) 63 5e-10 SB_40884| Best HMM Match : Homeobox (HMM E-Value=0.068) 63 5e-10 SB_40300| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_39391| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_39208| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_38658| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_38558| Best HMM Match : TFIIA_gamma_N (HMM E-Value=7.4) 63 5e-10 SB_38521| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_38282| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_38080| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_37703| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_37072| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_36830| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_36723| Best HMM Match : DUF753 (HMM E-Value=9.9) 63 5e-10 SB_36604| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_36374| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_35614| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_35131| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_34873| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_34844| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_34424| Best HMM Match : RNase_U2 (HMM E-Value=7.5) 63 5e-10 SB_34216| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_34007| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_33833| Best HMM Match : DUF947 (HMM E-Value=0.2) 63 5e-10 SB_33422| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_33231| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_32900| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_32024| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_31980| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_31865| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_31592| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_31481| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_31350| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_30835| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_30521| Best HMM Match : DUF333 (HMM E-Value=9.4) 63 5e-10 SB_30479| Best HMM Match : WD40 (HMM E-Value=1.1e-06) 63 5e-10 SB_30218| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_29851| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_29409| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_29177| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_29145| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_28808| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_28480| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_26038| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_25820| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_25742| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_25630| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_24684| Best HMM Match : Phage_rep_O (HMM E-Value=2.3) 63 5e-10 SB_24127| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_24102| Best HMM Match : DUF753 (HMM E-Value=9.4) 63 5e-10 SB_23875| Best HMM Match : Porin_3 (HMM E-Value=3.22299e-44) 63 5e-10 SB_23282| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_22993| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_22914| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_21520| Best HMM Match : Trypsin (HMM E-Value=0) 63 5e-10 SB_21177| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_20904| Best HMM Match : Filament_head (HMM E-Value=10) 63 5e-10 SB_20277| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_19885| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_19009| Best HMM Match : Sperm_Ag_HE2 (HMM E-Value=2.3) 63 5e-10 SB_18235| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_17265| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_16846| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_16672| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_16494| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_16270| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_16198| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_16182| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_15539| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_14857| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_14581| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_14087| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_13215| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_12828| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_12518| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_12140| Best HMM Match : ATP-synt_F (HMM E-Value=0.21) 63 5e-10 SB_12114| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_11228| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_11209| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_11018| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_10984| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_10523| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_10150| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_9428| Best HMM Match : Vicilin_N (HMM E-Value=4.2) 63 5e-10 SB_9090| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_8817| Best HMM Match : I-set (HMM E-Value=0) 63 5e-10 SB_8429| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_7590| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_7267| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_6665| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_6263| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_5632| Best HMM Match : XRN_N (HMM E-Value=3.9) 63 5e-10 SB_5073| Best HMM Match : Rhomboid (HMM E-Value=3.3) 63 5e-10 SB_4702| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_4674| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_4528| Best HMM Match : Antistasin (HMM E-Value=8.4) 63 5e-10 SB_4508| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_4402| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_4342| Best HMM Match : KA1 (HMM E-Value=0.53) 63 5e-10 SB_2432| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_2348| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_2263| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_1977| Best HMM Match : Filament_head (HMM E-Value=4.2) 63 5e-10 SB_1945| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_1808| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_1403| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_1283| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_1210| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_1178| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_1099| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_938| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_758| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_357| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 5e-10 SB_37693| Best HMM Match : PHD (HMM E-Value=8.7e-35) 63 7e-10 SB_38675| Best HMM Match : HEAT (HMM E-Value=0.0016) 62 2e-09 SB_55182| Best HMM Match : T4_deiodinase (HMM E-Value=0) 62 2e-09 SB_10099| Best HMM Match : Neur_chan_LBD (HMM E-Value=3.6e-17) 62 2e-09 SB_56660| Best HMM Match : zf-C2H2 (HMM E-Value=0) 61 2e-09 SB_29477| Best HMM Match : Antistasin (HMM E-Value=9.2) 61 2e-09 SB_10976| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 2e-09 SB_45914| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 3e-09 SB_35997| Best HMM Match : Phage_fiber (HMM E-Value=0.78) 61 3e-09 SB_52081| Best HMM Match : DUF1634 (HMM E-Value=0.55) 61 3e-09 SB_44358| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 3e-09 SB_55925| Best HMM Match : Homeobox (HMM E-Value=1e-26) 60 3e-09 SB_55030| Best HMM Match : Toxin_27 (HMM E-Value=1.2) 60 3e-09 SB_16590| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 3e-09 SB_59793| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 5e-09 SB_59635| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 5e-09 SB_59624| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 5e-09 SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 5e-09 SB_59550| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 5e-09 SB_59504| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 5e-09 SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 5e-09 SB_59286| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 5e-09 SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 5e-09 SB_58987| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 5e-09 SB_58779| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 5e-09 SB_58768| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 5e-09 SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 5e-09 SB_58723| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 5e-09 SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 5e-09 SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 5e-09 SB_58651| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 5e-09 SB_58615| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 5e-09 SB_58535| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 5e-09 SB_58509| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 5e-09 SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) 60 5e-09 SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 5e-09 SB_58076| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 5e-09 SB_57885| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 5e-09 SB_57850| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 5e-09 SB_57829| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 5e-09 SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 5e-09 SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) 60 5e-09 SB_57711| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 5e-09 SB_57692| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 5e-09 SB_57634| Best HMM Match : EGF_2 (HMM E-Value=0.0014) 60 5e-09 SB_57403| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 5e-09 SB_57371| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 5e-09 SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 5e-09 SB_57287| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 5e-09 SB_57259| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 5e-09 SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) 60 5e-09 SB_57194| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 5e-09 SB_57193| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 5e-09 SB_57151| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 5e-09 SB_57135| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 5e-09 SB_57120| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 5e-09 SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 5e-09 SB_56982| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 5e-09 SB_56880| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 5e-09 SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 5e-09 SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 5e-09 SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 5e-09 SB_56746| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 5e-09 SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 5e-09 SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 5e-09 SB_56676| Best HMM Match : Peptidase_C1 (HMM E-Value=0.0027) 60 5e-09 SB_56642| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 5e-09 SB_56581| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 5e-09 SB_56546| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 5e-09 SB_56496| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 5e-09 SB_56428| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 5e-09 SB_56281| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 5e-09 SB_56027| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 5e-09 SB_56013| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 5e-09 SB_55938| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 5e-09 SB_55921| Best HMM Match : Aldo_ket_red (HMM E-Value=0.16) 60 5e-09 SB_55868| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 5e-09 SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 5e-09 SB_55798| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 5e-09 SB_55789| Best HMM Match : ERG2_Sigma1R (HMM E-Value=3.6e-10) 60 5e-09 SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 5e-09 SB_55719| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 5e-09 SB_55703| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 5e-09 SB_55626| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 5e-09 SB_55592| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 5e-09 SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 5e-09 SB_55288| Best HMM Match : TLD (HMM E-Value=0.00092) 60 5e-09 SB_55192| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 5e-09 SB_55155| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 5e-09 SB_55099| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 5e-09 SB_55072| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 5e-09 SB_55011| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 5e-09 SB_54989| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 5e-09 SB_54840| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 5e-09 SB_54799| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 5e-09 SB_54578| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 5e-09 SB_54508| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 5e-09 SB_54473| Best HMM Match : DLIC (HMM E-Value=0) 60 5e-09 SB_54247| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 5e-09 SB_54170| Best HMM Match : Coronavirus_NS4 (HMM E-Value=6.1) 60 5e-09 SB_54136| Best HMM Match : YbgT_YccB (HMM E-Value=3) 60 5e-09 SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 5e-09 SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) 60 5e-09 SB_53753| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 5e-09 SB_53666| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 5e-09 SB_53625| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 5e-09 SB_53515| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 5e-09 SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 5e-09 SB_53366| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 5e-09 SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 5e-09 SB_53231| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 5e-09 SB_53118| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 5e-09 SB_52850| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 5e-09 SB_52844| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 5e-09 SB_52789| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 5e-09 SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 5e-09 SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 5e-09 SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 5e-09 SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) 60 5e-09 SB_52427| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 5e-09 SB_52394| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 5e-09 SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 5e-09 SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 5e-09 SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 5e-09 SB_52265| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 5e-09 SB_52260| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 5e-09 SB_52253| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 5e-09 SB_52161| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 5e-09 SB_52130| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 5e-09 SB_52086| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 5e-09 SB_52085| Best HMM Match : TIL (HMM E-Value=2.5) 60 5e-09 SB_51989| Best HMM Match : Extensin_2 (HMM E-Value=0.29) 60 5e-09 SB_51638| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 5e-09 SB_51529| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 5e-09 SB_51427| Best HMM Match : DUF855 (HMM E-Value=4) 60 5e-09 SB_51409| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 5e-09 SB_51320| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 5e-09 SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 5e-09 SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 5e-09 SB_50850| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 5e-09 SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) 60 5e-09 SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 5e-09 SB_50493| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 5e-09 SB_50473| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 5e-09 SB_50417| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 5e-09 SB_50270| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 5e-09 SB_50195| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 5e-09 SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 5e-09 SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 5e-09 SB_49896| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 5e-09 SB_49839| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 5e-09 SB_49814| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 5e-09 SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 5e-09 SB_49644| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 5e-09 SB_49542| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 5e-09 SB_49530| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 5e-09 SB_49495| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 5e-09 >SB_11396| Best HMM Match : Ribosomal_S2 (HMM E-Value=0) Length = 328 Score = 234 bits (573), Expect = 1e-61 Identities = 106/137 (77%), Positives = 121/137 (88%) Frame = +1 Query: 103 DPADVFVISSRAFGQRAVLKFAAHTGATPIAGRFTPGAFTNQIQAAFREPRLLIVLDPAQ 282 +PADV VIS+R +GQRA+LK+A+HTGATPIAGRFTPG FTNQIQAAFREPRLLIV DP Sbjct: 70 NPADVCVISARPYGQRAILKYASHTGATPIAGRFTPGTFTNQIQAAFREPRLLIVCDPRI 129 Query: 283 DHQPITEASYVNIPVIALCNTDSPLRFVDIAIPCNTKSSHSIGLMWWLLAREVLRLRGVL 462 DHQP+TEASYVNIPVIA CNTDSPLR VD+AIPCN K HSIGLM+WLLAREVLR+RG + Sbjct: 130 DHQPVTEASYVNIPVIAFCNTDSPLRHVDVAIPCNNKGIHSIGLMFWLLAREVLRMRGSI 189 Query: 463 SRDQRWDVVVDLFFYRD 513 SR W+++ DL+FYRD Sbjct: 190 SRALPWEIMPDLYFYRD 206 >SB_17237| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 78 Score = 74.5 bits (175), Expect = 2e-13 Identities = 38/52 (73%), Positives = 38/52 (73%) Frame = -1 Query: 1070 PFAIQXAXLLXRAIGRAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXAS 915 PFAIQ A LL RA SLLRQLAKGGCAARRLSW GF SRRCKT AS Sbjct: 11 PFAIQAAQLLEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 62 >SB_28519| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 72.9 bits (171), Expect = 6e-13 Identities = 35/54 (64%), Positives = 41/54 (75%) Frame = +2 Query: 884 IRPIVSRITIHWPXFYNVXTWENPGVTNLIALQHIPLSPAGVIAXRPARSPXPT 1045 +RP+VSRITIHW FYNV T + + NLIALQHIPLSPAGVIA AR+ P+ Sbjct: 33 LRPVVSRITIHWTSFYNVVTGKTLALPNLIALQHIPLSPAGVIA-EEARTDRPS 85 Score = 32.3 bits (70), Expect = 1.1 Identities = 22/51 (43%), Positives = 23/51 (45%), Gaps = 3/51 (5%) Frame = +3 Query: 927 FTTSXXGKTLALPT*SPCS---TSPFRQLA**RXGPPDRPXQQXRXLNGEW 1070 F GKTLALP SP +A DRP QQ R LNGEW Sbjct: 47 FYNVVTGKTLALPNLIALQHIPLSPAGVIA--EEARTDRPSQQLRSLNGEW 95 >SB_3496| Best HMM Match : Herpes_UL49_5 (HMM E-Value=7.2) Length = 98 Score = 72.5 bits (170), Expect = 8e-13 Identities = 34/48 (70%), Positives = 36/48 (75%) Frame = +2 Query: 899 SRITIHWPXFYNVXTWENPGVTNLIALQHIPLSPAGVIAXRPARSPXP 1042 SRITIHWP FYNV T + + NLIALQHIPLSPAGVIA RPA P Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNLIALQHIPLSPAGVIAKRPAPIALP 49 >SB_30142| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 72.1 bits (169), Expect = 1e-12 Identities = 37/52 (71%), Positives = 37/52 (71%) Frame = -1 Query: 1070 PFAIQXAXLLXRAIGRAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXAS 915 PFAIQ A L RA SLLRQLAKGGCAARRLSW GF SRRCKT AS Sbjct: 11 PFAIQAAQLWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 62 >SB_43825| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 72.1 bits (169), Expect = 1e-12 Identities = 37/52 (71%), Positives = 37/52 (71%) Frame = -1 Query: 1070 PFAIQXAXLLXRAIGRAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXAS 915 PFAIQ A L RA SLLRQLAKGGCAARRLSW GF SRRCKT AS Sbjct: 11 PFAIQAAQLWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 62 >SB_17217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 67.3 bits (157), Expect = 3e-11 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = -3 Query: 1053 CATVGKGDRAGLFAITPAGERGMCCKAIKL 964 CATVGKGDR GLFAITPAGERGMCCKAIKL Sbjct: 2 CATVGKGDRCGLFAITPAGERGMCCKAIKL 31 Score = 58.4 bits (135), Expect = 1e-08 Identities = 23/29 (79%), Positives = 25/29 (86%) Frame = -2 Query: 967 VGNARVFPXXDVVKRRPVNCNXTHYRANW 881 +GNA+ FP DVVKRRPVNCN THYRANW Sbjct: 31 LGNAKGFPSHDVVKRRPVNCNTTHYRANW 59 >SB_58792| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 66.9 bits (156), Expect = 4e-11 Identities = 32/39 (82%), Positives = 32/39 (82%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXASEL 909 RA SLLRQLAKGGCAARRLSW GF SRRCKT ASEL Sbjct: 19 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 57 Score = 31.1 bits (67), Expect = 2.4 Identities = 11/14 (78%), Positives = 11/14 (78%) Frame = -2 Query: 1069 HSPFRXRXCWXGRS 1028 HSPFR R CW GRS Sbjct: 4 HSPFRLRNCWEGRS 17 >SB_55579| Best HMM Match : Rhodanese (HMM E-Value=9.2e-29) Length = 269 Score = 66.9 bits (156), Expect = 4e-11 Identities = 32/39 (82%), Positives = 32/39 (82%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXASEL 909 RA SLLRQLAKGGCAARRLSW GF SRRCKT ASEL Sbjct: 231 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 269 Score = 31.1 bits (67), Expect = 2.4 Identities = 11/14 (78%), Positives = 11/14 (78%) Frame = -2 Query: 1069 HSPFRXRXCWXGRS 1028 HSPFR R CW GRS Sbjct: 216 HSPFRLRNCWEGRS 229 >SB_50054| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 937 Score = 66.9 bits (156), Expect = 4e-11 Identities = 32/39 (82%), Positives = 32/39 (82%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXASEL 909 RA SLLRQLAKGGCAARRLSW GF SRRCKT ASEL Sbjct: 899 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 937 >SB_49806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 66.9 bits (156), Expect = 4e-11 Identities = 32/39 (82%), Positives = 32/39 (82%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXASEL 909 RA SLLRQLAKGGCAARRLSW GF SRRCKT ASEL Sbjct: 12 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 50 >SB_47433| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 49 Score = 66.9 bits (156), Expect = 4e-11 Identities = 32/39 (82%), Positives = 32/39 (82%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXASEL 909 RA SLLRQLAKGGCAARRLSW GF SRRCKT ASEL Sbjct: 11 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 49 >SB_47291| Best HMM Match : PilN (HMM E-Value=0.75) Length = 424 Score = 66.9 bits (156), Expect = 4e-11 Identities = 32/39 (82%), Positives = 32/39 (82%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXASEL 909 RA SLLRQLAKGGCAARRLSW GF SRRCKT ASEL Sbjct: 386 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 424 Score = 31.9 bits (69), Expect = 1.4 Identities = 14/29 (48%), Positives = 14/29 (48%) Frame = -2 Query: 1114 LPNLPEFTKFYAXICHSPFRXRXCWXGRS 1028 L N F HSPFR R CW GRS Sbjct: 356 LRNYETLIGFKQGASHSPFRLRNCWEGRS 384 >SB_45437| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.53) Length = 273 Score = 66.9 bits (156), Expect = 4e-11 Identities = 32/39 (82%), Positives = 32/39 (82%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXASEL 909 RA SLLRQLAKGGCAARRLSW GF SRRCKT ASEL Sbjct: 235 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 273 >SB_42949| Best HMM Match : SRCR (HMM E-Value=1.6e-14) Length = 340 Score = 66.9 bits (156), Expect = 4e-11 Identities = 32/39 (82%), Positives = 32/39 (82%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXASEL 909 RA SLLRQLAKGGCAARRLSW GF SRRCKT ASEL Sbjct: 302 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 340 Score = 31.1 bits (67), Expect = 2.4 Identities = 11/14 (78%), Positives = 11/14 (78%) Frame = -2 Query: 1069 HSPFRXRXCWXGRS 1028 HSPFR R CW GRS Sbjct: 287 HSPFRLRNCWEGRS 300 >SB_40068| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) Length = 406 Score = 66.9 bits (156), Expect = 4e-11 Identities = 32/39 (82%), Positives = 32/39 (82%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXASEL 909 RA SLLRQLAKGGCAARRLSW GF SRRCKT ASEL Sbjct: 368 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 406 >SB_36207| Best HMM Match : 7kD_coat (HMM E-Value=7.6) Length = 98 Score = 66.9 bits (156), Expect = 4e-11 Identities = 32/39 (82%), Positives = 32/39 (82%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXASEL 909 RA SLLRQLAKGGCAARRLSW GF SRRCKT ASEL Sbjct: 60 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 98 >SB_31511| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 372 Score = 66.9 bits (156), Expect = 4e-11 Identities = 32/39 (82%), Positives = 32/39 (82%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXASEL 909 RA SLLRQLAKGGCAARRLSW GF SRRCKT ASEL Sbjct: 19 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 57 Score = 31.1 bits (67), Expect = 2.4 Identities = 11/14 (78%), Positives = 11/14 (78%) Frame = -2 Query: 1069 HSPFRXRXCWXGRS 1028 HSPFR R CW GRS Sbjct: 4 HSPFRLRNCWEGRS 17 >SB_29521| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 66.9 bits (156), Expect = 4e-11 Identities = 33/44 (75%), Positives = 33/44 (75%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXASEL*XDSL 894 RA SLLRQLAKGGCAARRLSW GF SRRCKT ASE D L Sbjct: 19 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEFPGDPL 62 Score = 60.1 bits (139), Expect = 5e-09 Identities = 29/37 (78%), Positives = 29/37 (78%) Frame = +1 Query: 916 LAXVLQRRDXGKPWRYQLNRLAAHPPFASWRNSEXAR 1026 LA VLQRRD P QLNRLAAHPPFASWRNSE AR Sbjct: 85 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEAR 121 Score = 31.1 bits (67), Expect = 2.4 Identities = 11/14 (78%), Positives = 11/14 (78%) Frame = -2 Query: 1069 HSPFRXRXCWXGRS 1028 HSPFR R CW GRS Sbjct: 4 HSPFRLRNCWEGRS 17 Score = 29.9 bits (64), Expect = 5.7 Identities = 11/14 (78%), Positives = 11/14 (78%) Frame = +3 Query: 1029 DRPXQQXRXLNGEW 1070 DRP QQ R LNGEW Sbjct: 123 DRPSQQLRSLNGEW 136 >SB_27897| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 66.9 bits (156), Expect = 4e-11 Identities = 32/39 (82%), Positives = 32/39 (82%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXASEL 909 RA SLLRQLAKGGCAARRLSW GF SRRCKT ASEL Sbjct: 12 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 50 >SB_27010| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 66.9 bits (156), Expect = 4e-11 Identities = 32/39 (82%), Positives = 32/39 (82%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXASEL 909 RA SLLRQLAKGGCAARRLSW GF SRRCKT ASEL Sbjct: 12 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 50 >SB_26995| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 66.9 bits (156), Expect = 4e-11 Identities = 32/39 (82%), Positives = 32/39 (82%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXASEL 909 RA SLLRQLAKGGCAARRLSW GF SRRCKT ASEL Sbjct: 19 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 57 Score = 31.1 bits (67), Expect = 2.4 Identities = 11/14 (78%), Positives = 11/14 (78%) Frame = -2 Query: 1069 HSPFRXRXCWXGRS 1028 HSPFR R CW GRS Sbjct: 4 HSPFRLRNCWEGRS 17 >SB_20900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 66.9 bits (156), Expect = 4e-11 Identities = 32/39 (82%), Positives = 32/39 (82%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXASEL 909 RA SLLRQLAKGGCAARRLSW GF SRRCKT ASEL Sbjct: 19 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 57 Score = 31.1 bits (67), Expect = 2.4 Identities = 11/14 (78%), Positives = 11/14 (78%) Frame = -2 Query: 1069 HSPFRXRXCWXGRS 1028 HSPFR R CW GRS Sbjct: 4 HSPFRLRNCWEGRS 17 >SB_20814| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 66.9 bits (156), Expect = 4e-11 Identities = 32/39 (82%), Positives = 32/39 (82%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXASEL 909 RA SLLRQLAKGGCAARRLSW GF SRRCKT ASEL Sbjct: 42 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 80 Score = 32.3 bits (70), Expect = 1.1 Identities = 12/22 (54%), Positives = 14/22 (63%) Frame = -2 Query: 1093 TKFYAXICHSPFRXRXCWXGRS 1028 T+ + HSPFR R CW GRS Sbjct: 19 TREFQGASHSPFRLRNCWEGRS 40 >SB_15447| Best HMM Match : C1_1 (HMM E-Value=0.11) Length = 316 Score = 66.9 bits (156), Expect = 4e-11 Identities = 32/39 (82%), Positives = 32/39 (82%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXASEL 909 RA SLLRQLAKGGCAARRLSW GF SRRCKT ASEL Sbjct: 278 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 316 >SB_14175| Best HMM Match : GBP_repeat (HMM E-Value=3.8) Length = 300 Score = 66.9 bits (156), Expect = 4e-11 Identities = 32/39 (82%), Positives = 32/39 (82%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXASEL 909 RA SLLRQLAKGGCAARRLSW GF SRRCKT ASEL Sbjct: 262 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 300 >SB_8424| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 66.9 bits (156), Expect = 4e-11 Identities = 32/39 (82%), Positives = 32/39 (82%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXASEL 909 RA SLLRQLAKGGCAARRLSW GF SRRCKT ASEL Sbjct: 12 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 50 >SB_6796| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 925 Score = 66.9 bits (156), Expect = 4e-11 Identities = 35/65 (53%), Positives = 39/65 (60%) Frame = -1 Query: 1106 FTGIYKILRXNLPFAIQXAXLLXRAIGRAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCK 927 F G + R + P+ + RA SLLRQLAKGGCAARRLSW GF SRRCK Sbjct: 514 FEGHESVSRNSTPYTQRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCK 573 Query: 926 TXASE 912 T ASE Sbjct: 574 TTASE 578 >SB_56358| Best HMM Match : Fork_head (HMM E-Value=1.2e-30) Length = 289 Score = 66.9 bits (156), Expect = 4e-11 Identities = 32/39 (82%), Positives = 32/39 (82%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXASEL 909 RA SLLRQLAKGGCAARRLSW GF SRRCKT ASEL Sbjct: 251 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 289 >SB_56058| Best HMM Match : Phasin (HMM E-Value=2.7) Length = 314 Score = 66.9 bits (156), Expect = 4e-11 Identities = 32/39 (82%), Positives = 32/39 (82%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXASEL 909 RA SLLRQLAKGGCAARRLSW GF SRRCKT ASEL Sbjct: 276 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 314 Score = 31.1 bits (67), Expect = 2.4 Identities = 11/14 (78%), Positives = 11/14 (78%) Frame = -2 Query: 1069 HSPFRXRXCWXGRS 1028 HSPFR R CW GRS Sbjct: 261 HSPFRLRNCWEGRS 274 >SB_52523| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 498 Score = 66.9 bits (156), Expect = 4e-11 Identities = 32/39 (82%), Positives = 32/39 (82%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXASEL 909 RA SLLRQLAKGGCAARRLSW GF SRRCKT ASEL Sbjct: 460 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 498 Score = 31.1 bits (67), Expect = 2.4 Identities = 11/14 (78%), Positives = 11/14 (78%) Frame = -2 Query: 1069 HSPFRXRXCWXGRS 1028 HSPFR R CW GRS Sbjct: 445 HSPFRLRNCWEGRS 458 >SB_48632| Best HMM Match : DUF265 (HMM E-Value=7.6e-22) Length = 455 Score = 66.9 bits (156), Expect = 4e-11 Identities = 32/39 (82%), Positives = 32/39 (82%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXASEL 909 RA SLLRQLAKGGCAARRLSW GF SRRCKT ASEL Sbjct: 129 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 167 >SB_46830| Best HMM Match : Succ_DH_flav_C (HMM E-Value=3.2e-37) Length = 333 Score = 66.9 bits (156), Expect = 4e-11 Identities = 32/39 (82%), Positives = 32/39 (82%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXASEL 909 RA SLLRQLAKGGCAARRLSW GF SRRCKT ASEL Sbjct: 295 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 333 Score = 32.3 bits (70), Expect = 1.1 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = -2 Query: 1084 YAXICHSPFRXRXCWXGRS 1028 Y HSPFR R CW GRS Sbjct: 275 YKGASHSPFRLRNCWEGRS 293 >SB_42128| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 66.9 bits (156), Expect = 4e-11 Identities = 32/39 (82%), Positives = 32/39 (82%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXASEL 909 RA SLLRQLAKGGCAARRLSW GF SRRCKT ASEL Sbjct: 145 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 183 Score = 31.1 bits (67), Expect = 2.4 Identities = 11/14 (78%), Positives = 11/14 (78%) Frame = -2 Query: 1069 HSPFRXRXCWXGRS 1028 HSPFR R CW GRS Sbjct: 130 HSPFRLRNCWEGRS 143 >SB_40139| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 66.9 bits (156), Expect = 4e-11 Identities = 32/39 (82%), Positives = 32/39 (82%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXASEL 909 RA SLLRQLAKGGCAARRLSW GF SRRCKT ASEL Sbjct: 19 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 57 Score = 31.1 bits (67), Expect = 2.4 Identities = 11/14 (78%), Positives = 11/14 (78%) Frame = -2 Query: 1069 HSPFRXRXCWXGRS 1028 HSPFR R CW GRS Sbjct: 4 HSPFRLRNCWEGRS 17 >SB_31293| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 66.9 bits (156), Expect = 4e-11 Identities = 32/39 (82%), Positives = 32/39 (82%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXASEL 909 RA SLLRQLAKGGCAARRLSW GF SRRCKT ASEL Sbjct: 19 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 57 Score = 31.1 bits (67), Expect = 2.4 Identities = 11/14 (78%), Positives = 11/14 (78%) Frame = -2 Query: 1069 HSPFRXRXCWXGRS 1028 HSPFR R CW GRS Sbjct: 4 HSPFRLRNCWEGRS 17 >SB_30699| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 43 Score = 66.9 bits (156), Expect = 4e-11 Identities = 32/39 (82%), Positives = 32/39 (82%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXASEL 909 RA SLLRQLAKGGCAARRLSW GF SRRCKT ASEL Sbjct: 5 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 43 >SB_29464| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 242 Score = 66.9 bits (156), Expect = 4e-11 Identities = 32/39 (82%), Positives = 32/39 (82%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXASEL 909 RA SLLRQLAKGGCAARRLSW GF SRRCKT ASEL Sbjct: 204 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 242 >SB_25673| Best HMM Match : MFS_1 (HMM E-Value=0.18) Length = 634 Score = 66.9 bits (156), Expect = 4e-11 Identities = 32/39 (82%), Positives = 32/39 (82%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXASEL 909 RA SLLRQLAKGGCAARRLSW GF SRRCKT ASEL Sbjct: 596 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 634 Score = 31.1 bits (67), Expect = 2.4 Identities = 11/14 (78%), Positives = 11/14 (78%) Frame = -2 Query: 1069 HSPFRXRXCWXGRS 1028 HSPFR R CW GRS Sbjct: 581 HSPFRLRNCWEGRS 594 >SB_24724| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2021 Score = 66.9 bits (156), Expect = 4e-11 Identities = 32/39 (82%), Positives = 32/39 (82%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXASEL 909 RA SLLRQLAKGGCAARRLSW GF SRRCKT ASEL Sbjct: 232 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 270 >SB_17049| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 548 Score = 66.9 bits (156), Expect = 4e-11 Identities = 32/39 (82%), Positives = 32/39 (82%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXASEL 909 RA SLLRQLAKGGCAARRLSW GF SRRCKT ASEL Sbjct: 510 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 548 Score = 32.3 bits (70), Expect = 1.1 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = -2 Query: 1084 YAXICHSPFRXRXCWXGRS 1028 Y HSPFR R CW GRS Sbjct: 490 YQGASHSPFRLRNCWEGRS 508 >SB_12580| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 66.9 bits (156), Expect = 4e-11 Identities = 32/39 (82%), Positives = 32/39 (82%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXASEL 909 RA SLLRQLAKGGCAARRLSW GF SRRCKT ASEL Sbjct: 93 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 131 >SB_11401| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 439 Score = 66.9 bits (156), Expect = 4e-11 Identities = 32/39 (82%), Positives = 32/39 (82%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXASEL 909 RA SLLRQLAKGGCAARRLSW GF SRRCKT ASEL Sbjct: 401 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 439 >SB_10689| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 43 Score = 66.9 bits (156), Expect = 4e-11 Identities = 32/39 (82%), Positives = 32/39 (82%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXASEL 909 RA SLLRQLAKGGCAARRLSW GF SRRCKT ASEL Sbjct: 5 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 43 >SB_9250| Best HMM Match : BAG (HMM E-Value=6.2) Length = 232 Score = 66.9 bits (156), Expect = 4e-11 Identities = 32/39 (82%), Positives = 32/39 (82%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXASEL 909 RA SLLRQLAKGGCAARRLSW GF SRRCKT ASEL Sbjct: 194 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 232 Score = 31.1 bits (67), Expect = 2.4 Identities = 11/14 (78%), Positives = 11/14 (78%) Frame = -2 Query: 1069 HSPFRXRXCWXGRS 1028 HSPFR R CW GRS Sbjct: 179 HSPFRLRNCWEGRS 192 >SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) Length = 2506 Score = 65.7 bits (153), Expect = 9e-11 Identities = 33/63 (52%), Positives = 33/63 (52%) Frame = -2 Query: 1069 HSPFRXRXCWXGRSGGPXRYYASWRKGDVLQGD*VGNARVFPXXDVVKRRPVNCNXTHYR 890 HSPFR R CW GRS KG FP DVVKRRPVNCN THYR Sbjct: 589 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWG---FPSHDVVKRRPVNCNTTHYR 645 Query: 889 ANW 881 ANW Sbjct: 646 ANW 648 >SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) Length = 281 Score = 65.7 bits (153), Expect = 9e-11 Identities = 33/63 (52%), Positives = 33/63 (52%) Frame = -2 Query: 1069 HSPFRXRXCWXGRSGGPXRYYASWRKGDVLQGD*VGNARVFPXXDVVKRRPVNCNXTHYR 890 HSPFR R CW GRS KG FP DVVKRRPVNCN THYR Sbjct: 32 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWG---FPSHDVVKRRPVNCNTTHYR 88 Query: 889 ANW 881 ANW Sbjct: 89 ANW 91 >SB_4159| Best HMM Match : Vpu (HMM E-Value=2) Length = 779 Score = 65.7 bits (153), Expect = 9e-11 Identities = 33/63 (52%), Positives = 33/63 (52%) Frame = -2 Query: 1069 HSPFRXRXCWXGRSGGPXRYYASWRKGDVLQGD*VGNARVFPXXDVVKRRPVNCNXTHYR 890 HSPFR R CW GRS KG FP DVVKRRPVNCN THYR Sbjct: 32 HSPFRLRNCWEGRSVRASSLLRQLAKGGCAARRLSWG---FPSHDVVKRRPVNCNTTHYR 88 Query: 889 ANW 881 ANW Sbjct: 89 ANW 91 >SB_46484| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 117 Score = 65.3 bits (152), Expect = 1e-10 Identities = 36/72 (50%), Positives = 40/72 (55%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXASEL*XDSL*GELGTGPPLEVXXXX 846 RA SLLRQLAKGGCAARRLSW GF SRRCKT AS G+ V Sbjct: 34 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTASAKLACLQVDSRGSPGHFYVLSAS 93 Query: 845 XXFSCYIQTKVY 810 SC++Q V+ Sbjct: 94 LMCSCFVQDPVH 105 Score = 31.1 bits (67), Expect = 2.4 Identities = 11/14 (78%), Positives = 11/14 (78%) Frame = -2 Query: 1069 HSPFRXRXCWXGRS 1028 HSPFR R CW GRS Sbjct: 19 HSPFRLRNCWEGRS 32 >SB_24487| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 65.3 bits (152), Expect = 1e-10 Identities = 31/52 (59%), Positives = 37/52 (71%) Frame = +2 Query: 890 PIVSRITIHWPXFYNVXTWENPGVTNLIALQHIPLSPAGVIAXRPARSPXPT 1045 P +SRITIHWP FYNV T + + NLIALQHIPLSPAG + AR+ P+ Sbjct: 77 PYMSRITIHWPSFYNVVTGKTLALPNLIALQHIPLSPAG-LHREEARTDRPS 127 Score = 33.9 bits (74), Expect = 0.35 Identities = 21/49 (42%), Positives = 21/49 (42%), Gaps = 1/49 (2%) Frame = +3 Query: 927 FTTSXXGKTLALPT*SPCSTSPFRQLA**RX-GPPDRPXQQXRXLNGEW 1070 F GKTLALP P R DRP QQ R LNGEW Sbjct: 89 FYNVVTGKTLALPNLIALQHIPLSPAGLHREEARTDRPSQQLRSLNGEW 137 >SB_17246| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 602 Score = 64.5 bits (150), Expect = 2e-10 Identities = 29/39 (74%), Positives = 31/39 (79%), Gaps = 1/39 (2%) Frame = -2 Query: 994 KGDVLQGD*-VGNARVFPXXDVVKRRPVNCNXTHYRANW 881 KGDVLQGD +G + FP DVVKRRPVNCN THYRANW Sbjct: 64 KGDVLQGDLKLGKRQGFPSHDVVKRRPVNCNTTHYRANW 102 Score = 32.3 bits (70), Expect = 1.1 Identities = 15/33 (45%), Positives = 20/33 (60%) Frame = -3 Query: 1086 FTLQFAIRHSGCATVGKGDRAGLFAITPAGERG 988 F L+ + +G+ AGLFAITPAGE+G Sbjct: 33 FILRSDLPSQAAQLLGRAIGAGLFAITPAGEKG 65 >SB_13077| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 64.1 bits (149), Expect = 3e-10 Identities = 26/33 (78%), Positives = 26/33 (78%) Frame = -2 Query: 1069 HSPFRXRXCWXGRSGGPXRYYASWRKGDVLQGD 971 HSPFR R CW G GP RYYASWRKGDVLQGD Sbjct: 32 HSPFRLRNCWEGDRCGPLRYYASWRKGDVLQGD 64 >SB_45641| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 63.7 bits (148), Expect = 4e-10 Identities = 31/49 (63%), Positives = 35/49 (71%) Frame = +2 Query: 899 SRITIHWPXFYNVXTWENPGVTNLIALQHIPLSPAGVIAXRPARSPXPT 1045 SRITIHWP FYNV T + + NLIALQHIPLSPAGV AR+ P+ Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNLIALQHIPLSPAGV-NSEEARTDRPS 49 Score = 31.9 bits (69), Expect = 1.4 Identities = 20/49 (40%), Positives = 20/49 (40%), Gaps = 1/49 (2%) Frame = +3 Query: 927 FTTSXXGKTLALPT*SPCSTSPFRQLA**-RXGPPDRPXQQXRXLNGEW 1070 F GKTLALP P DRP QQ R LNGEW Sbjct: 11 FYNVVTGKTLALPNLIALQHIPLSPAGVNSEEARTDRPSQQLRSLNGEW 59 >SB_32211| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 109 Score = 63.7 bits (148), Expect = 4e-10 Identities = 29/43 (67%), Positives = 31/43 (72%) Frame = +2 Query: 914 HWPXFYNVXTWENPGVTNLIALQHIPLSPAGVIAXRPARSPXP 1042 HWP FYNV T + + NLIALQHIPLSPAGVIA RPA P Sbjct: 62 HWPSFYNVVTGKTLALPNLIALQHIPLSPAGVIAKRPAPIALP 104 >SB_1214| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 104 Score = 63.7 bits (148), Expect = 4e-10 Identities = 29/43 (67%), Positives = 31/43 (72%) Frame = +2 Query: 914 HWPXFYNVXTWENPGVTNLIALQHIPLSPAGVIAXRPARSPXP 1042 HWP FYNV T + + NLIALQHIPLSPAGVIA RPA P Sbjct: 57 HWPSFYNVVTGKTLALPNLIALQHIPLSPAGVIAKRPAPIALP 99 >SB_59802| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3213 Score = 63.3 bits (147), Expect = 5e-10 Identities = 30/37 (81%), Positives = 30/37 (81%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXAS 915 RA SLLRQLAKGGCAARRLSW GF SRRCKT AS Sbjct: 487 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 523 Score = 31.1 bits (67), Expect = 2.4 Identities = 11/14 (78%), Positives = 11/14 (78%) Frame = -2 Query: 1069 HSPFRXRXCWXGRS 1028 HSPFR R CW GRS Sbjct: 472 HSPFRLRNCWEGRS 485 >SB_59119| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 55 Score = 63.3 bits (147), Expect = 5e-10 Identities = 30/37 (81%), Positives = 30/37 (81%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXAS 915 RA SLLRQLAKGGCAARRLSW GF SRRCKT AS Sbjct: 12 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_58967| Best HMM Match : Sec23_BS (HMM E-Value=5.9) Length = 123 Score = 63.3 bits (147), Expect = 5e-10 Identities = 30/37 (81%), Positives = 30/37 (81%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXAS 915 RA SLLRQLAKGGCAARRLSW GF SRRCKT AS Sbjct: 34 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 Score = 31.1 bits (67), Expect = 2.4 Identities = 11/14 (78%), Positives = 11/14 (78%) Frame = -2 Query: 1069 HSPFRXRXCWXGRS 1028 HSPFR R CW GRS Sbjct: 19 HSPFRLRNCWEGRS 32 >SB_58852| Best HMM Match : Hormone_4 (HMM E-Value=2.8) Length = 212 Score = 63.3 bits (147), Expect = 5e-10 Identities = 30/37 (81%), Positives = 30/37 (81%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXAS 915 RA SLLRQLAKGGCAARRLSW GF SRRCKT AS Sbjct: 157 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 193 >SB_58713| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 55 Score = 63.3 bits (147), Expect = 5e-10 Identities = 30/37 (81%), Positives = 30/37 (81%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXAS 915 RA SLLRQLAKGGCAARRLSW GF SRRCKT AS Sbjct: 12 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_58195| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 63.3 bits (147), Expect = 5e-10 Identities = 30/37 (81%), Positives = 30/37 (81%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXAS 915 RA SLLRQLAKGGCAARRLSW GF SRRCKT AS Sbjct: 12 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_58029| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 63.3 bits (147), Expect = 5e-10 Identities = 30/37 (81%), Positives = 30/37 (81%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXAS 915 RA SLLRQLAKGGCAARRLSW GF SRRCKT AS Sbjct: 12 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_56603| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 63.3 bits (147), Expect = 5e-10 Identities = 30/37 (81%), Positives = 30/37 (81%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXAS 915 RA SLLRQLAKGGCAARRLSW GF SRRCKT AS Sbjct: 12 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_56369| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 328 Score = 63.3 bits (147), Expect = 5e-10 Identities = 30/37 (81%), Positives = 30/37 (81%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXAS 915 RA SLLRQLAKGGCAARRLSW GF SRRCKT AS Sbjct: 234 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 270 >SB_55830| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 431 Score = 63.3 bits (147), Expect = 5e-10 Identities = 30/37 (81%), Positives = 30/37 (81%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXAS 915 RA SLLRQLAKGGCAARRLSW GF SRRCKT AS Sbjct: 378 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 414 >SB_54985| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 63.3 bits (147), Expect = 5e-10 Identities = 30/37 (81%), Positives = 30/37 (81%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXAS 915 RA SLLRQLAKGGCAARRLSW GF SRRCKT AS Sbjct: 12 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_54503| Best HMM Match : DUF753 (HMM E-Value=4.7) Length = 141 Score = 63.3 bits (147), Expect = 5e-10 Identities = 30/37 (81%), Positives = 30/37 (81%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXAS 915 RA SLLRQLAKGGCAARRLSW GF SRRCKT AS Sbjct: 34 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 Score = 31.1 bits (67), Expect = 2.4 Identities = 11/14 (78%), Positives = 11/14 (78%) Frame = -2 Query: 1069 HSPFRXRXCWXGRS 1028 HSPFR R CW GRS Sbjct: 19 HSPFRLRNCWEGRS 32 >SB_53675| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 69 Score = 63.3 bits (147), Expect = 5e-10 Identities = 30/37 (81%), Positives = 30/37 (81%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXAS 915 RA SLLRQLAKGGCAARRLSW GF SRRCKT AS Sbjct: 12 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_53669| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 77 Score = 63.3 bits (147), Expect = 5e-10 Identities = 30/37 (81%), Positives = 30/37 (81%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXAS 915 RA SLLRQLAKGGCAARRLSW GF SRRCKT AS Sbjct: 12 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_53077| Best HMM Match : SRP54_N (HMM E-Value=1.8) Length = 533 Score = 63.3 bits (147), Expect = 5e-10 Identities = 30/37 (81%), Positives = 30/37 (81%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXAS 915 RA SLLRQLAKGGCAARRLSW GF SRRCKT AS Sbjct: 80 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 116 Score = 31.1 bits (67), Expect = 2.4 Identities = 11/14 (78%), Positives = 11/14 (78%) Frame = -2 Query: 1069 HSPFRXRXCWXGRS 1028 HSPFR R CW GRS Sbjct: 65 HSPFRLRNCWEGRS 78 >SB_52837| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 67 Score = 63.3 bits (147), Expect = 5e-10 Identities = 30/37 (81%), Positives = 30/37 (81%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXAS 915 RA SLLRQLAKGGCAARRLSW GF SRRCKT AS Sbjct: 12 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_51967| Best HMM Match : Wzy_C (HMM E-Value=7.3) Length = 185 Score = 63.3 bits (147), Expect = 5e-10 Identities = 30/37 (81%), Positives = 30/37 (81%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXAS 915 RA SLLRQLAKGGCAARRLSW GF SRRCKT AS Sbjct: 34 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 Score = 31.1 bits (67), Expect = 2.4 Identities = 11/14 (78%), Positives = 11/14 (78%) Frame = -2 Query: 1069 HSPFRXRXCWXGRS 1028 HSPFR R CW GRS Sbjct: 19 HSPFRLRNCWEGRS 32 >SB_50928| Best HMM Match : 7tm_2 (HMM E-Value=4.7e-07) Length = 1127 Score = 63.3 bits (147), Expect = 5e-10 Identities = 30/37 (81%), Positives = 30/37 (81%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXAS 915 RA SLLRQLAKGGCAARRLSW GF SRRCKT AS Sbjct: 661 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 697 Score = 31.1 bits (67), Expect = 2.4 Identities = 11/14 (78%), Positives = 11/14 (78%) Frame = -2 Query: 1069 HSPFRXRXCWXGRS 1028 HSPFR R CW GRS Sbjct: 646 HSPFRLRNCWEGRS 659 >SB_50489| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 63.3 bits (147), Expect = 5e-10 Identities = 30/37 (81%), Positives = 30/37 (81%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXAS 915 RA SLLRQLAKGGCAARRLSW GF SRRCKT AS Sbjct: 12 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_50209| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 473 Score = 63.3 bits (147), Expect = 5e-10 Identities = 30/37 (81%), Positives = 30/37 (81%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXAS 915 RA SLLRQLAKGGCAARRLSW GF SRRCKT AS Sbjct: 12 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_50159| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 63.3 bits (147), Expect = 5e-10 Identities = 30/37 (81%), Positives = 30/37 (81%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXAS 915 RA SLLRQLAKGGCAARRLSW GF SRRCKT AS Sbjct: 12 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_48422| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 63.3 bits (147), Expect = 5e-10 Identities = 30/37 (81%), Positives = 30/37 (81%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXAS 915 RA SLLRQLAKGGCAARRLSW GF SRRCKT AS Sbjct: 34 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 Score = 31.1 bits (67), Expect = 2.4 Identities = 11/14 (78%), Positives = 11/14 (78%) Frame = -2 Query: 1069 HSPFRXRXCWXGRS 1028 HSPFR R CW GRS Sbjct: 19 HSPFRLRNCWEGRS 32 >SB_47991| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 63.3 bits (147), Expect = 5e-10 Identities = 30/37 (81%), Positives = 30/37 (81%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXAS 915 RA SLLRQLAKGGCAARRLSW GF SRRCKT AS Sbjct: 12 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_47859| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 63.3 bits (147), Expect = 5e-10 Identities = 30/37 (81%), Positives = 30/37 (81%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXAS 915 RA SLLRQLAKGGCAARRLSW GF SRRCKT AS Sbjct: 12 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_46080| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 68 Score = 63.3 bits (147), Expect = 5e-10 Identities = 30/37 (81%), Positives = 30/37 (81%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXAS 915 RA SLLRQLAKGGCAARRLSW GF SRRCKT AS Sbjct: 12 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_45570| Best HMM Match : Euplotes_phero (HMM E-Value=2.6) Length = 388 Score = 63.3 bits (147), Expect = 5e-10 Identities = 30/37 (81%), Positives = 30/37 (81%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXAS 915 RA SLLRQLAKGGCAARRLSW GF SRRCKT AS Sbjct: 12 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_45449| Best HMM Match : Glyco_hydro_47 (HMM E-Value=1.4e-07) Length = 305 Score = 63.3 bits (147), Expect = 5e-10 Identities = 30/37 (81%), Positives = 30/37 (81%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXAS 915 RA SLLRQLAKGGCAARRLSW GF SRRCKT AS Sbjct: 12 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_43819| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 63.3 bits (147), Expect = 5e-10 Identities = 30/37 (81%), Positives = 30/37 (81%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXAS 915 RA SLLRQLAKGGCAARRLSW GF SRRCKT AS Sbjct: 12 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_42373| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 68 Score = 63.3 bits (147), Expect = 5e-10 Identities = 30/37 (81%), Positives = 30/37 (81%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXAS 915 RA SLLRQLAKGGCAARRLSW GF SRRCKT AS Sbjct: 12 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_42112| Best HMM Match : Herpes_UL49_2 (HMM E-Value=1.5) Length = 154 Score = 63.3 bits (147), Expect = 5e-10 Identities = 30/37 (81%), Positives = 30/37 (81%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXAS 915 RA SLLRQLAKGGCAARRLSW GF SRRCKT AS Sbjct: 12 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_41613| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 49 Score = 63.3 bits (147), Expect = 5e-10 Identities = 31/39 (79%), Positives = 31/39 (79%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXASEL 909 RA SLLRQLAKGGCAARRLSW F SRRCKT ASEL Sbjct: 11 RASSLLRQLAKGGCAARRLSWVTPVFSQSRRCKTTASEL 49 >SB_41202| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 63.3 bits (147), Expect = 5e-10 Identities = 30/37 (81%), Positives = 30/37 (81%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXAS 915 RA SLLRQLAKGGCAARRLSW GF SRRCKT AS Sbjct: 12 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_41136| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 115 Score = 63.3 bits (147), Expect = 5e-10 Identities = 30/37 (81%), Positives = 30/37 (81%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXAS 915 RA SLLRQLAKGGCAARRLSW GF SRRCKT AS Sbjct: 12 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_41068| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 63.3 bits (147), Expect = 5e-10 Identities = 30/37 (81%), Positives = 30/37 (81%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXAS 915 RA SLLRQLAKGGCAARRLSW GF SRRCKT AS Sbjct: 34 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 Score = 31.1 bits (67), Expect = 2.4 Identities = 11/14 (78%), Positives = 11/14 (78%) Frame = -2 Query: 1069 HSPFRXRXCWXGRS 1028 HSPFR R CW GRS Sbjct: 19 HSPFRLRNCWEGRS 32 >SB_40980| Best HMM Match : ANF_receptor (HMM E-Value=0.00014) Length = 735 Score = 63.3 bits (147), Expect = 5e-10 Identities = 30/37 (81%), Positives = 30/37 (81%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXAS 915 RA SLLRQLAKGGCAARRLSW GF SRRCKT AS Sbjct: 570 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 606 Score = 31.1 bits (67), Expect = 2.4 Identities = 11/14 (78%), Positives = 11/14 (78%) Frame = -2 Query: 1069 HSPFRXRXCWXGRS 1028 HSPFR R CW GRS Sbjct: 555 HSPFRLRNCWEGRS 568 >SB_40764| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 63.3 bits (147), Expect = 5e-10 Identities = 30/37 (81%), Positives = 30/37 (81%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXAS 915 RA SLLRQLAKGGCAARRLSW GF SRRCKT AS Sbjct: 12 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_40601| Best HMM Match : VWA_CoxE (HMM E-Value=6.3) Length = 666 Score = 63.3 bits (147), Expect = 5e-10 Identities = 30/37 (81%), Positives = 30/37 (81%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXAS 915 RA SLLRQLAKGGCAARRLSW GF SRRCKT AS Sbjct: 417 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 453 >SB_40576| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 63.3 bits (147), Expect = 5e-10 Identities = 30/37 (81%), Positives = 30/37 (81%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXAS 915 RA SLLRQLAKGGCAARRLSW GF SRRCKT AS Sbjct: 12 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_40463| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 63.3 bits (147), Expect = 5e-10 Identities = 30/37 (81%), Positives = 30/37 (81%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXAS 915 RA SLLRQLAKGGCAARRLSW GF SRRCKT AS Sbjct: 12 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_40182| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 63.3 bits (147), Expect = 5e-10 Identities = 30/37 (81%), Positives = 30/37 (81%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXAS 915 RA SLLRQLAKGGCAARRLSW GF SRRCKT AS Sbjct: 12 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_40003| Best HMM Match : YTV (HMM E-Value=8.9) Length = 128 Score = 63.3 bits (147), Expect = 5e-10 Identities = 30/37 (81%), Positives = 30/37 (81%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXAS 915 RA SLLRQLAKGGCAARRLSW GF SRRCKT AS Sbjct: 12 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_39444| Best HMM Match : SAC3_GANP (HMM E-Value=0.68) Length = 794 Score = 63.3 bits (147), Expect = 5e-10 Identities = 30/37 (81%), Positives = 30/37 (81%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXAS 915 RA SLLRQLAKGGCAARRLSW GF SRRCKT AS Sbjct: 12 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_38813| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 66 Score = 63.3 bits (147), Expect = 5e-10 Identities = 30/37 (81%), Positives = 30/37 (81%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXAS 915 RA SLLRQLAKGGCAARRLSW GF SRRCKT AS Sbjct: 12 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_38774| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 104 Score = 63.3 bits (147), Expect = 5e-10 Identities = 30/37 (81%), Positives = 30/37 (81%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXAS 915 RA SLLRQLAKGGCAARRLSW GF SRRCKT AS Sbjct: 34 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 Score = 31.1 bits (67), Expect = 2.4 Identities = 11/14 (78%), Positives = 11/14 (78%) Frame = -2 Query: 1069 HSPFRXRXCWXGRS 1028 HSPFR R CW GRS Sbjct: 19 HSPFRLRNCWEGRS 32 >SB_38425| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 114 Score = 63.3 bits (147), Expect = 5e-10 Identities = 30/37 (81%), Positives = 30/37 (81%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXAS 915 RA SLLRQLAKGGCAARRLSW GF SRRCKT AS Sbjct: 34 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 Score = 31.1 bits (67), Expect = 2.4 Identities = 11/14 (78%), Positives = 11/14 (78%) Frame = -2 Query: 1069 HSPFRXRXCWXGRS 1028 HSPFR R CW GRS Sbjct: 19 HSPFRLRNCWEGRS 32 >SB_38203| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 63.3 bits (147), Expect = 5e-10 Identities = 30/37 (81%), Positives = 30/37 (81%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXAS 915 RA SLLRQLAKGGCAARRLSW GF SRRCKT AS Sbjct: 12 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_37771| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 101 Score = 63.3 bits (147), Expect = 5e-10 Identities = 30/37 (81%), Positives = 30/37 (81%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXAS 915 RA SLLRQLAKGGCAARRLSW GF SRRCKT AS Sbjct: 44 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 80 >SB_36681| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1081 Score = 63.3 bits (147), Expect = 5e-10 Identities = 30/37 (81%), Positives = 30/37 (81%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXAS 915 RA SLLRQLAKGGCAARRLSW GF SRRCKT AS Sbjct: 800 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 836 >SB_36014| Best HMM Match : DUF437 (HMM E-Value=6.4) Length = 240 Score = 63.3 bits (147), Expect = 5e-10 Identities = 30/37 (81%), Positives = 30/37 (81%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXAS 915 RA SLLRQLAKGGCAARRLSW GF SRRCKT AS Sbjct: 34 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 Score = 31.1 bits (67), Expect = 2.4 Identities = 11/14 (78%), Positives = 11/14 (78%) Frame = -2 Query: 1069 HSPFRXRXCWXGRS 1028 HSPFR R CW GRS Sbjct: 19 HSPFRLRNCWEGRS 32 >SB_35849| Best HMM Match : Fibrinogen_C (HMM E-Value=0.15) Length = 631 Score = 63.3 bits (147), Expect = 5e-10 Identities = 30/37 (81%), Positives = 30/37 (81%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXAS 915 RA SLLRQLAKGGCAARRLSW GF SRRCKT AS Sbjct: 461 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 497 >SB_35317| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 77 Score = 63.3 bits (147), Expect = 5e-10 Identities = 30/37 (81%), Positives = 30/37 (81%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXAS 915 RA SLLRQLAKGGCAARRLSW GF SRRCKT AS Sbjct: 12 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_35151| Best HMM Match : DUF589 (HMM E-Value=7.5) Length = 297 Score = 63.3 bits (147), Expect = 5e-10 Identities = 30/37 (81%), Positives = 30/37 (81%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXAS 915 RA SLLRQLAKGGCAARRLSW GF SRRCKT AS Sbjct: 34 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 Score = 31.1 bits (67), Expect = 2.4 Identities = 11/14 (78%), Positives = 11/14 (78%) Frame = -2 Query: 1069 HSPFRXRXCWXGRS 1028 HSPFR R CW GRS Sbjct: 19 HSPFRLRNCWEGRS 32 >SB_34685| Best HMM Match : RNA_pol_A_bac (HMM E-Value=1.8) Length = 143 Score = 63.3 bits (147), Expect = 5e-10 Identities = 30/37 (81%), Positives = 30/37 (81%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXAS 915 RA SLLRQLAKGGCAARRLSW GF SRRCKT AS Sbjct: 34 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 Score = 31.1 bits (67), Expect = 2.4 Identities = 11/14 (78%), Positives = 11/14 (78%) Frame = -2 Query: 1069 HSPFRXRXCWXGRS 1028 HSPFR R CW GRS Sbjct: 19 HSPFRLRNCWEGRS 32 >SB_34478| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 63.3 bits (147), Expect = 5e-10 Identities = 30/37 (81%), Positives = 30/37 (81%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXAS 915 RA SLLRQLAKGGCAARRLSW GF SRRCKT AS Sbjct: 80 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 116 >SB_31889| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 63.3 bits (147), Expect = 5e-10 Identities = 30/37 (81%), Positives = 30/37 (81%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXAS 915 RA SLLRQLAKGGCAARRLSW GF SRRCKT AS Sbjct: 34 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 Score = 31.1 bits (67), Expect = 2.4 Identities = 11/14 (78%), Positives = 11/14 (78%) Frame = -2 Query: 1069 HSPFRXRXCWXGRS 1028 HSPFR R CW GRS Sbjct: 19 HSPFRLRNCWEGRS 32 >SB_29043| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 68 Score = 63.3 bits (147), Expect = 5e-10 Identities = 30/37 (81%), Positives = 30/37 (81%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXAS 915 RA SLLRQLAKGGCAARRLSW GF SRRCKT AS Sbjct: 12 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_28650| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 63.3 bits (147), Expect = 5e-10 Identities = 30/37 (81%), Positives = 30/37 (81%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXAS 915 RA SLLRQLAKGGCAARRLSW GF SRRCKT AS Sbjct: 12 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_28487| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 63.3 bits (147), Expect = 5e-10 Identities = 30/37 (81%), Positives = 30/37 (81%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXAS 915 RA SLLRQLAKGGCAARRLSW GF SRRCKT AS Sbjct: 12 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_28424| Best HMM Match : SAM_1 (HMM E-Value=8e-06) Length = 214 Score = 63.3 bits (147), Expect = 5e-10 Identities = 30/37 (81%), Positives = 30/37 (81%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXAS 915 RA SLLRQLAKGGCAARRLSW GF SRRCKT AS Sbjct: 12 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_28245| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 63.3 bits (147), Expect = 5e-10 Identities = 30/37 (81%), Positives = 30/37 (81%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXAS 915 RA SLLRQLAKGGCAARRLSW GF SRRCKT AS Sbjct: 12 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_27137| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 63.3 bits (147), Expect = 5e-10 Identities = 30/37 (81%), Positives = 30/37 (81%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXAS 915 RA SLLRQLAKGGCAARRLSW GF SRRCKT AS Sbjct: 12 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_27095| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 534 Score = 63.3 bits (147), Expect = 5e-10 Identities = 30/37 (81%), Positives = 30/37 (81%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXAS 915 RA SLLRQLAKGGCAARRLSW GF SRRCKT AS Sbjct: 382 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 418 >SB_26954| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 63.3 bits (147), Expect = 5e-10 Identities = 30/37 (81%), Positives = 30/37 (81%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXAS 915 RA SLLRQLAKGGCAARRLSW GF SRRCKT AS Sbjct: 12 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_26672| Best HMM Match : Exo_endo_phos (HMM E-Value=0.46) Length = 1232 Score = 63.3 bits (147), Expect = 5e-10 Identities = 30/37 (81%), Positives = 30/37 (81%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXAS 915 RA SLLRQLAKGGCAARRLSW GF SRRCKT AS Sbjct: 1116 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 1152 >SB_26607| Best HMM Match : K_tetra (HMM E-Value=3.3e-08) Length = 412 Score = 63.3 bits (147), Expect = 5e-10 Identities = 30/37 (81%), Positives = 30/37 (81%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXAS 915 RA SLLRQLAKGGCAARRLSW GF SRRCKT AS Sbjct: 307 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 343 >SB_25727| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1758 Score = 63.3 bits (147), Expect = 5e-10 Identities = 30/37 (81%), Positives = 30/37 (81%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXAS 915 RA SLLRQLAKGGCAARRLSW GF SRRCKT AS Sbjct: 121 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 157 >SB_25469| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 87 Score = 63.3 bits (147), Expect = 5e-10 Identities = 30/37 (81%), Positives = 30/37 (81%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXAS 915 RA SLLRQLAKGGCAARRLSW GF SRRCKT AS Sbjct: 31 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 67 >SB_25193| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 63.3 bits (147), Expect = 5e-10 Identities = 30/37 (81%), Positives = 30/37 (81%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXAS 915 RA SLLRQLAKGGCAARRLSW GF SRRCKT AS Sbjct: 12 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_23294| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 63.3 bits (147), Expect = 5e-10 Identities = 30/37 (81%), Positives = 30/37 (81%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXAS 915 RA SLLRQLAKGGCAARRLSW GF SRRCKT AS Sbjct: 12 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_23196| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 67 Score = 63.3 bits (147), Expect = 5e-10 Identities = 30/37 (81%), Positives = 30/37 (81%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXAS 915 RA SLLRQLAKGGCAARRLSW GF SRRCKT AS Sbjct: 5 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 41 >SB_23195| Best HMM Match : zf-C3HC4 (HMM E-Value=1.3e-10) Length = 466 Score = 63.3 bits (147), Expect = 5e-10 Identities = 30/37 (81%), Positives = 30/37 (81%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXAS 915 RA SLLRQLAKGGCAARRLSW GF SRRCKT AS Sbjct: 12 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_22108| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 83 Score = 63.3 bits (147), Expect = 5e-10 Identities = 30/37 (81%), Positives = 30/37 (81%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXAS 915 RA SLLRQLAKGGCAARRLSW GF SRRCKT AS Sbjct: 12 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_21853| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 79 Score = 63.3 bits (147), Expect = 5e-10 Identities = 30/37 (81%), Positives = 30/37 (81%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXAS 915 RA SLLRQLAKGGCAARRLSW GF SRRCKT AS Sbjct: 12 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_21523| Best HMM Match : Pkinase (HMM E-Value=9.5e-14) Length = 322 Score = 63.3 bits (147), Expect = 5e-10 Identities = 30/37 (81%), Positives = 30/37 (81%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXAS 915 RA SLLRQLAKGGCAARRLSW GF SRRCKT AS Sbjct: 34 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 Score = 31.1 bits (67), Expect = 2.4 Identities = 11/14 (78%), Positives = 11/14 (78%) Frame = -2 Query: 1069 HSPFRXRXCWXGRS 1028 HSPFR R CW GRS Sbjct: 19 HSPFRLRNCWEGRS 32 >SB_20847| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 117 Score = 63.3 bits (147), Expect = 5e-10 Identities = 30/37 (81%), Positives = 30/37 (81%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXAS 915 RA SLLRQLAKGGCAARRLSW GF SRRCKT AS Sbjct: 34 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 Score = 31.1 bits (67), Expect = 2.4 Identities = 11/14 (78%), Positives = 11/14 (78%) Frame = -2 Query: 1069 HSPFRXRXCWXGRS 1028 HSPFR R CW GRS Sbjct: 19 HSPFRLRNCWEGRS 32 >SB_20629| Best HMM Match : WD40 (HMM E-Value=0.0014) Length = 230 Score = 63.3 bits (147), Expect = 5e-10 Identities = 30/37 (81%), Positives = 30/37 (81%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXAS 915 RA SLLRQLAKGGCAARRLSW GF SRRCKT AS Sbjct: 47 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 83 Score = 31.1 bits (67), Expect = 2.4 Identities = 11/14 (78%), Positives = 11/14 (78%) Frame = -2 Query: 1069 HSPFRXRXCWXGRS 1028 HSPFR R CW GRS Sbjct: 32 HSPFRLRNCWEGRS 45 >SB_18983| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 78 Score = 63.3 bits (147), Expect = 5e-10 Identities = 30/37 (81%), Positives = 30/37 (81%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXAS 915 RA SLLRQLAKGGCAARRLSW GF SRRCKT AS Sbjct: 12 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_18796| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 63.3 bits (147), Expect = 5e-10 Identities = 30/37 (81%), Positives = 30/37 (81%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXAS 915 RA SLLRQLAKGGCAARRLSW GF SRRCKT AS Sbjct: 12 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_18538| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 189 Score = 63.3 bits (147), Expect = 5e-10 Identities = 30/37 (81%), Positives = 30/37 (81%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXAS 915 RA SLLRQLAKGGCAARRLSW GF SRRCKT AS Sbjct: 34 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 Score = 31.1 bits (67), Expect = 2.4 Identities = 11/14 (78%), Positives = 11/14 (78%) Frame = -2 Query: 1069 HSPFRXRXCWXGRS 1028 HSPFR R CW GRS Sbjct: 19 HSPFRLRNCWEGRS 32 >SB_18411| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.3 bits (147), Expect = 5e-10 Identities = 30/37 (81%), Positives = 30/37 (81%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXAS 915 RA SLLRQLAKGGCAARRLSW GF SRRCKT AS Sbjct: 34 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 Score = 31.1 bits (67), Expect = 2.4 Identities = 11/14 (78%), Positives = 11/14 (78%) Frame = -2 Query: 1069 HSPFRXRXCWXGRS 1028 HSPFR R CW GRS Sbjct: 19 HSPFRLRNCWEGRS 32 >SB_18318| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 63.3 bits (147), Expect = 5e-10 Identities = 30/37 (81%), Positives = 30/37 (81%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXAS 915 RA SLLRQLAKGGCAARRLSW GF SRRCKT AS Sbjct: 12 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_18158| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 63.3 bits (147), Expect = 5e-10 Identities = 30/37 (81%), Positives = 30/37 (81%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXAS 915 RA SLLRQLAKGGCAARRLSW GF SRRCKT AS Sbjct: 34 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 Score = 31.1 bits (67), Expect = 2.4 Identities = 11/14 (78%), Positives = 11/14 (78%) Frame = -2 Query: 1069 HSPFRXRXCWXGRS 1028 HSPFR R CW GRS Sbjct: 19 HSPFRLRNCWEGRS 32 >SB_15818| Best HMM Match : Apo-VLDL-II (HMM E-Value=1.2) Length = 218 Score = 63.3 bits (147), Expect = 5e-10 Identities = 30/37 (81%), Positives = 30/37 (81%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXAS 915 RA SLLRQLAKGGCAARRLSW GF SRRCKT AS Sbjct: 34 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 Score = 31.1 bits (67), Expect = 2.4 Identities = 11/14 (78%), Positives = 11/14 (78%) Frame = -2 Query: 1069 HSPFRXRXCWXGRS 1028 HSPFR R CW GRS Sbjct: 19 HSPFRLRNCWEGRS 32 >SB_15375| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 63.3 bits (147), Expect = 5e-10 Identities = 30/37 (81%), Positives = 30/37 (81%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXAS 915 RA SLLRQLAKGGCAARRLSW GF SRRCKT AS Sbjct: 12 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_14672| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 66 Score = 63.3 bits (147), Expect = 5e-10 Identities = 30/37 (81%), Positives = 30/37 (81%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXAS 915 RA SLLRQLAKGGCAARRLSW GF SRRCKT AS Sbjct: 12 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_14518| Best HMM Match : MIB_HERC2 (HMM E-Value=2.4e-38) Length = 742 Score = 63.3 bits (147), Expect = 5e-10 Identities = 30/37 (81%), Positives = 30/37 (81%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXAS 915 RA SLLRQLAKGGCAARRLSW GF SRRCKT AS Sbjct: 497 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 533 >SB_14044| Best HMM Match : EGF_CA (HMM E-Value=4.1e-13) Length = 184 Score = 63.3 bits (147), Expect = 5e-10 Identities = 30/37 (81%), Positives = 30/37 (81%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXAS 915 RA SLLRQLAKGGCAARRLSW GF SRRCKT AS Sbjct: 12 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_13919| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 83 Score = 63.3 bits (147), Expect = 5e-10 Identities = 30/37 (81%), Positives = 30/37 (81%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXAS 915 RA SLLRQLAKGGCAARRLSW GF SRRCKT AS Sbjct: 12 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_13475| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 63.3 bits (147), Expect = 5e-10 Identities = 30/37 (81%), Positives = 30/37 (81%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXAS 915 RA SLLRQLAKGGCAARRLSW GF SRRCKT AS Sbjct: 12 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_13295| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 66 Score = 63.3 bits (147), Expect = 5e-10 Identities = 30/37 (81%), Positives = 30/37 (81%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXAS 915 RA SLLRQLAKGGCAARRLSW GF SRRCKT AS Sbjct: 12 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_13049| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 63.3 bits (147), Expect = 5e-10 Identities = 30/37 (81%), Positives = 30/37 (81%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXAS 915 RA SLLRQLAKGGCAARRLSW GF SRRCKT AS Sbjct: 12 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_12559| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 63.3 bits (147), Expect = 5e-10 Identities = 30/37 (81%), Positives = 30/37 (81%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXAS 915 RA SLLRQLAKGGCAARRLSW GF SRRCKT AS Sbjct: 12 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_12016| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 81 Score = 63.3 bits (147), Expect = 5e-10 Identities = 30/37 (81%), Positives = 30/37 (81%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXAS 915 RA SLLRQLAKGGCAARRLSW GF SRRCKT AS Sbjct: 12 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_11991| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 63.3 bits (147), Expect = 5e-10 Identities = 30/37 (81%), Positives = 30/37 (81%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXAS 915 RA SLLRQLAKGGCAARRLSW GF SRRCKT AS Sbjct: 105 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 141 >SB_11294| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 63.3 bits (147), Expect = 5e-10 Identities = 30/37 (81%), Positives = 30/37 (81%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXAS 915 RA SLLRQLAKGGCAARRLSW GF SRRCKT AS Sbjct: 65 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 101 >SB_10247| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 63.3 bits (147), Expect = 5e-10 Identities = 30/37 (81%), Positives = 30/37 (81%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXAS 915 RA SLLRQLAKGGCAARRLSW GF SRRCKT AS Sbjct: 12 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_9391| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 67 Score = 63.3 bits (147), Expect = 5e-10 Identities = 30/37 (81%), Positives = 30/37 (81%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXAS 915 RA SLLRQLAKGGCAARRLSW GF SRRCKT AS Sbjct: 12 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_9055| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 63.3 bits (147), Expect = 5e-10 Identities = 30/37 (81%), Positives = 30/37 (81%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXAS 915 RA SLLRQLAKGGCAARRLSW GF SRRCKT AS Sbjct: 12 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_8565| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 63.3 bits (147), Expect = 5e-10 Identities = 30/37 (81%), Positives = 30/37 (81%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXAS 915 RA SLLRQLAKGGCAARRLSW GF SRRCKT AS Sbjct: 12 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_8222| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 63.3 bits (147), Expect = 5e-10 Identities = 30/37 (81%), Positives = 30/37 (81%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXAS 915 RA SLLRQLAKGGCAARRLSW GF SRRCKT AS Sbjct: 67 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 103 >SB_8126| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 63.3 bits (147), Expect = 5e-10 Identities = 30/37 (81%), Positives = 30/37 (81%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXAS 915 RA SLLRQLAKGGCAARRLSW GF SRRCKT AS Sbjct: 12 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_7261| Best HMM Match : RHS (HMM E-Value=5.3) Length = 137 Score = 63.3 bits (147), Expect = 5e-10 Identities = 30/37 (81%), Positives = 30/37 (81%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXAS 915 RA SLLRQLAKGGCAARRLSW GF SRRCKT AS Sbjct: 34 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 Score = 31.1 bits (67), Expect = 2.4 Identities = 11/14 (78%), Positives = 11/14 (78%) Frame = -2 Query: 1069 HSPFRXRXCWXGRS 1028 HSPFR R CW GRS Sbjct: 19 HSPFRLRNCWEGRS 32 >SB_7005| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 67 Score = 63.3 bits (147), Expect = 5e-10 Identities = 30/37 (81%), Positives = 30/37 (81%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXAS 915 RA SLLRQLAKGGCAARRLSW GF SRRCKT AS Sbjct: 12 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_6339| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 114 Score = 63.3 bits (147), Expect = 5e-10 Identities = 30/37 (81%), Positives = 30/37 (81%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXAS 915 RA SLLRQLAKGGCAARRLSW GF SRRCKT AS Sbjct: 61 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 97 >SB_6047| Best HMM Match : CXC (HMM E-Value=7.7) Length = 90 Score = 63.3 bits (147), Expect = 5e-10 Identities = 30/37 (81%), Positives = 30/37 (81%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXAS 915 RA SLLRQLAKGGCAARRLSW GF SRRCKT AS Sbjct: 12 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_5753| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 63.3 bits (147), Expect = 5e-10 Identities = 30/37 (81%), Positives = 30/37 (81%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXAS 915 RA SLLRQLAKGGCAARRLSW GF SRRCKT AS Sbjct: 12 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_5503| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 63.3 bits (147), Expect = 5e-10 Identities = 30/37 (81%), Positives = 30/37 (81%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXAS 915 RA SLLRQLAKGGCAARRLSW GF SRRCKT AS Sbjct: 12 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_5427| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 374 Score = 63.3 bits (147), Expect = 5e-10 Identities = 30/37 (81%), Positives = 30/37 (81%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXAS 915 RA SLLRQLAKGGCAARRLSW GF SRRCKT AS Sbjct: 12 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_4286| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 69 Score = 63.3 bits (147), Expect = 5e-10 Identities = 30/37 (81%), Positives = 30/37 (81%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXAS 915 RA SLLRQLAKGGCAARRLSW GF SRRCKT AS Sbjct: 12 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_4268| Best HMM Match : MtrG (HMM E-Value=1.2) Length = 542 Score = 63.3 bits (147), Expect = 5e-10 Identities = 30/37 (81%), Positives = 30/37 (81%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXAS 915 RA SLLRQLAKGGCAARRLSW GF SRRCKT AS Sbjct: 166 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 202 >SB_4192| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 63.3 bits (147), Expect = 5e-10 Identities = 30/37 (81%), Positives = 30/37 (81%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXAS 915 RA SLLRQLAKGGCAARRLSW GF SRRCKT AS Sbjct: 12 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_3720| Best HMM Match : RVT_1 (HMM E-Value=0.0031) Length = 546 Score = 63.3 bits (147), Expect = 5e-10 Identities = 30/37 (81%), Positives = 30/37 (81%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXAS 915 RA SLLRQLAKGGCAARRLSW GF SRRCKT AS Sbjct: 12 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_3671| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 63.3 bits (147), Expect = 5e-10 Identities = 30/37 (81%), Positives = 30/37 (81%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXAS 915 RA SLLRQLAKGGCAARRLSW GF SRRCKT AS Sbjct: 34 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 Score = 31.1 bits (67), Expect = 2.4 Identities = 11/14 (78%), Positives = 11/14 (78%) Frame = -2 Query: 1069 HSPFRXRXCWXGRS 1028 HSPFR R CW GRS Sbjct: 19 HSPFRLRNCWEGRS 32 >SB_2384| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 63.3 bits (147), Expect = 5e-10 Identities = 30/37 (81%), Positives = 30/37 (81%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXAS 915 RA SLLRQLAKGGCAARRLSW GF SRRCKT AS Sbjct: 34 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 Score = 31.1 bits (67), Expect = 2.4 Identities = 11/14 (78%), Positives = 11/14 (78%) Frame = -2 Query: 1069 HSPFRXRXCWXGRS 1028 HSPFR R CW GRS Sbjct: 19 HSPFRLRNCWEGRS 32 >SB_1609| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 63.3 bits (147), Expect = 5e-10 Identities = 30/37 (81%), Positives = 30/37 (81%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXAS 915 RA SLLRQLAKGGCAARRLSW GF SRRCKT AS Sbjct: 12 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_751| Best HMM Match : rve (HMM E-Value=7.5e-12) Length = 338 Score = 63.3 bits (147), Expect = 5e-10 Identities = 30/37 (81%), Positives = 30/37 (81%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXAS 915 RA SLLRQLAKGGCAARRLSW GF SRRCKT AS Sbjct: 34 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 Score = 31.1 bits (67), Expect = 2.4 Identities = 11/14 (78%), Positives = 11/14 (78%) Frame = -2 Query: 1069 HSPFRXRXCWXGRS 1028 HSPFR R CW GRS Sbjct: 19 HSPFRLRNCWEGRS 32 >SB_266| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 63.3 bits (147), Expect = 5e-10 Identities = 30/37 (81%), Positives = 30/37 (81%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXAS 915 RA SLLRQLAKGGCAARRLSW GF SRRCKT AS Sbjct: 12 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_59| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 63.3 bits (147), Expect = 5e-10 Identities = 30/37 (81%), Positives = 30/37 (81%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXAS 915 RA SLLRQLAKGGCAARRLSW GF SRRCKT AS Sbjct: 12 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_58440| Best HMM Match : Ribosomal_L9_C (HMM E-Value=0.81) Length = 427 Score = 63.3 bits (147), Expect = 5e-10 Identities = 30/37 (81%), Positives = 30/37 (81%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXAS 915 RA SLLRQLAKGGCAARRLSW GF SRRCKT AS Sbjct: 34 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 Score = 31.1 bits (67), Expect = 2.4 Identities = 11/14 (78%), Positives = 11/14 (78%) Frame = -2 Query: 1069 HSPFRXRXCWXGRS 1028 HSPFR R CW GRS Sbjct: 19 HSPFRLRNCWEGRS 32 >SB_58394| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 63.3 bits (147), Expect = 5e-10 Identities = 30/37 (81%), Positives = 30/37 (81%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXAS 915 RA SLLRQLAKGGCAARRLSW GF SRRCKT AS Sbjct: 12 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_57506| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 77 Score = 63.3 bits (147), Expect = 5e-10 Identities = 30/37 (81%), Positives = 30/37 (81%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXAS 915 RA SLLRQLAKGGCAARRLSW GF SRRCKT AS Sbjct: 12 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_57021| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 63.3 bits (147), Expect = 5e-10 Identities = 30/37 (81%), Positives = 30/37 (81%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXAS 915 RA SLLRQLAKGGCAARRLSW GF SRRCKT AS Sbjct: 12 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_56970| Best HMM Match : Thaumatin (HMM E-Value=5.4) Length = 200 Score = 63.3 bits (147), Expect = 5e-10 Identities = 30/37 (81%), Positives = 30/37 (81%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXAS 915 RA SLLRQLAKGGCAARRLSW GF SRRCKT AS Sbjct: 34 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 Score = 31.1 bits (67), Expect = 2.4 Identities = 11/14 (78%), Positives = 11/14 (78%) Frame = -2 Query: 1069 HSPFRXRXCWXGRS 1028 HSPFR R CW GRS Sbjct: 19 HSPFRLRNCWEGRS 32 >SB_56955| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 87 Score = 63.3 bits (147), Expect = 5e-10 Identities = 30/37 (81%), Positives = 30/37 (81%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXAS 915 RA SLLRQLAKGGCAARRLSW GF SRRCKT AS Sbjct: 26 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 62 Score = 31.1 bits (67), Expect = 2.4 Identities = 11/14 (78%), Positives = 11/14 (78%) Frame = -2 Query: 1069 HSPFRXRXCWXGRS 1028 HSPFR R CW GRS Sbjct: 11 HSPFRLRNCWEGRS 24 >SB_56767| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 63.3 bits (147), Expect = 5e-10 Identities = 30/37 (81%), Positives = 30/37 (81%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXAS 915 RA SLLRQLAKGGCAARRLSW GF SRRCKT AS Sbjct: 12 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_56729| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 63.3 bits (147), Expect = 5e-10 Identities = 30/37 (81%), Positives = 30/37 (81%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXAS 915 RA SLLRQLAKGGCAARRLSW GF SRRCKT AS Sbjct: 12 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_56672| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 63.3 bits (147), Expect = 5e-10 Identities = 30/37 (81%), Positives = 30/37 (81%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXAS 915 RA SLLRQLAKGGCAARRLSW GF SRRCKT AS Sbjct: 12 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_56555| Best HMM Match : 7tm_1 (HMM E-Value=4.4) Length = 220 Score = 63.3 bits (147), Expect = 5e-10 Identities = 30/37 (81%), Positives = 30/37 (81%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXAS 915 RA SLLRQLAKGGCAARRLSW GF SRRCKT AS Sbjct: 12 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_56099| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 63.3 bits (147), Expect = 5e-10 Identities = 30/37 (81%), Positives = 30/37 (81%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXAS 915 RA SLLRQLAKGGCAARRLSW GF SRRCKT AS Sbjct: 12 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_55954| Best HMM Match : TIL (HMM E-Value=0.74) Length = 172 Score = 63.3 bits (147), Expect = 5e-10 Identities = 30/37 (81%), Positives = 30/37 (81%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXAS 915 RA SLLRQLAKGGCAARRLSW GF SRRCKT AS Sbjct: 34 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 Score = 31.1 bits (67), Expect = 2.4 Identities = 11/14 (78%), Positives = 11/14 (78%) Frame = -2 Query: 1069 HSPFRXRXCWXGRS 1028 HSPFR R CW GRS Sbjct: 19 HSPFRLRNCWEGRS 32 >SB_55138| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 63.3 bits (147), Expect = 5e-10 Identities = 30/37 (81%), Positives = 30/37 (81%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXAS 915 RA SLLRQLAKGGCAARRLSW GF SRRCKT AS Sbjct: 12 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_55112| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 67 Score = 63.3 bits (147), Expect = 5e-10 Identities = 30/37 (81%), Positives = 30/37 (81%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXAS 915 RA SLLRQLAKGGCAARRLSW GF SRRCKT AS Sbjct: 12 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_54421| Best HMM Match : HipA_C (HMM E-Value=7.5) Length = 248 Score = 63.3 bits (147), Expect = 5e-10 Identities = 30/37 (81%), Positives = 30/37 (81%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXAS 915 RA SLLRQLAKGGCAARRLSW GF SRRCKT AS Sbjct: 34 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 Score = 31.1 bits (67), Expect = 2.4 Identities = 11/14 (78%), Positives = 11/14 (78%) Frame = -2 Query: 1069 HSPFRXRXCWXGRS 1028 HSPFR R CW GRS Sbjct: 19 HSPFRLRNCWEGRS 32 >SB_54343| Best HMM Match : TipAS (HMM E-Value=0.77) Length = 316 Score = 63.3 bits (147), Expect = 5e-10 Identities = 30/37 (81%), Positives = 30/37 (81%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXAS 915 RA SLLRQLAKGGCAARRLSW GF SRRCKT AS Sbjct: 12 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_54153| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 79 Score = 63.3 bits (147), Expect = 5e-10 Identities = 30/37 (81%), Positives = 30/37 (81%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXAS 915 RA SLLRQLAKGGCAARRLSW GF SRRCKT AS Sbjct: 12 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_54005| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 74 Score = 63.3 bits (147), Expect = 5e-10 Identities = 30/37 (81%), Positives = 30/37 (81%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXAS 915 RA SLLRQLAKGGCAARRLSW GF SRRCKT AS Sbjct: 12 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_53974| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 69 Score = 63.3 bits (147), Expect = 5e-10 Identities = 30/37 (81%), Positives = 30/37 (81%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXAS 915 RA SLLRQLAKGGCAARRLSW GF SRRCKT AS Sbjct: 12 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_53662| Best HMM Match : Protamine_P2 (HMM E-Value=9.2) Length = 253 Score = 63.3 bits (147), Expect = 5e-10 Identities = 30/37 (81%), Positives = 30/37 (81%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXAS 915 RA SLLRQLAKGGCAARRLSW GF SRRCKT AS Sbjct: 203 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 239 Score = 31.1 bits (67), Expect = 2.4 Identities = 11/14 (78%), Positives = 11/14 (78%) Frame = -2 Query: 1069 HSPFRXRXCWXGRS 1028 HSPFR R CW GRS Sbjct: 188 HSPFRLRNCWEGRS 201 >SB_53598| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 196 Score = 63.3 bits (147), Expect = 5e-10 Identities = 30/37 (81%), Positives = 30/37 (81%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXAS 915 RA SLLRQLAKGGCAARRLSW GF SRRCKT AS Sbjct: 139 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 175 >SB_53044| Best HMM Match : TcpA (HMM E-Value=3.1) Length = 195 Score = 63.3 bits (147), Expect = 5e-10 Identities = 30/37 (81%), Positives = 30/37 (81%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXAS 915 RA SLLRQLAKGGCAARRLSW GF SRRCKT AS Sbjct: 34 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 Score = 31.1 bits (67), Expect = 2.4 Identities = 11/14 (78%), Positives = 11/14 (78%) Frame = -2 Query: 1069 HSPFRXRXCWXGRS 1028 HSPFR R CW GRS Sbjct: 19 HSPFRLRNCWEGRS 32 >SB_52956| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 63.3 bits (147), Expect = 5e-10 Identities = 30/37 (81%), Positives = 30/37 (81%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXAS 915 RA SLLRQLAKGGCAARRLSW GF SRRCKT AS Sbjct: 12 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_51739| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 191 Score = 63.3 bits (147), Expect = 5e-10 Identities = 30/37 (81%), Positives = 30/37 (81%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXAS 915 RA SLLRQLAKGGCAARRLSW GF SRRCKT AS Sbjct: 12 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_51732| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 81 Score = 63.3 bits (147), Expect = 5e-10 Identities = 30/37 (81%), Positives = 30/37 (81%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXAS 915 RA SLLRQLAKGGCAARRLSW GF SRRCKT AS Sbjct: 12 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_51109| Best HMM Match : ATP-cone (HMM E-Value=0.76) Length = 250 Score = 63.3 bits (147), Expect = 5e-10 Identities = 30/37 (81%), Positives = 30/37 (81%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXAS 915 RA SLLRQLAKGGCAARRLSW GF SRRCKT AS Sbjct: 12 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_50972| Best HMM Match : MH1 (HMM E-Value=7.1) Length = 283 Score = 63.3 bits (147), Expect = 5e-10 Identities = 30/37 (81%), Positives = 30/37 (81%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXAS 915 RA SLLRQLAKGGCAARRLSW GF SRRCKT AS Sbjct: 110 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 146 >SB_50818| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 109 Score = 63.3 bits (147), Expect = 5e-10 Identities = 30/37 (81%), Positives = 30/37 (81%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXAS 915 RA SLLRQLAKGGCAARRLSW GF SRRCKT AS Sbjct: 34 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 Score = 31.1 bits (67), Expect = 2.4 Identities = 11/14 (78%), Positives = 11/14 (78%) Frame = -2 Query: 1069 HSPFRXRXCWXGRS 1028 HSPFR R CW GRS Sbjct: 19 HSPFRLRNCWEGRS 32 >SB_50491| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 55 Score = 63.3 bits (147), Expect = 5e-10 Identities = 30/37 (81%), Positives = 30/37 (81%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXAS 915 RA SLLRQLAKGGCAARRLSW GF SRRCKT AS Sbjct: 12 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_50286| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 63.3 bits (147), Expect = 5e-10 Identities = 30/37 (81%), Positives = 30/37 (81%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXAS 915 RA SLLRQLAKGGCAARRLSW GF SRRCKT AS Sbjct: 12 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_50222| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 167 Score = 63.3 bits (147), Expect = 5e-10 Identities = 30/37 (81%), Positives = 30/37 (81%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXAS 915 RA SLLRQLAKGGCAARRLSW GF SRRCKT AS Sbjct: 34 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 Score = 31.1 bits (67), Expect = 2.4 Identities = 11/14 (78%), Positives = 11/14 (78%) Frame = -2 Query: 1069 HSPFRXRXCWXGRS 1028 HSPFR R CW GRS Sbjct: 19 HSPFRLRNCWEGRS 32 >SB_50081| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 63.3 bits (147), Expect = 5e-10 Identities = 30/37 (81%), Positives = 30/37 (81%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXAS 915 RA SLLRQLAKGGCAARRLSW GF SRRCKT AS Sbjct: 12 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_50019| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 849 Score = 63.3 bits (147), Expect = 5e-10 Identities = 30/37 (81%), Positives = 30/37 (81%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXAS 915 RA SLLRQLAKGGCAARRLSW GF SRRCKT AS Sbjct: 66 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 102 >SB_49981| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 82 Score = 63.3 bits (147), Expect = 5e-10 Identities = 30/37 (81%), Positives = 30/37 (81%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXAS 915 RA SLLRQLAKGGCAARRLSW GF SRRCKT AS Sbjct: 12 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_49899| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 63.3 bits (147), Expect = 5e-10 Identities = 30/37 (81%), Positives = 30/37 (81%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXAS 915 RA SLLRQLAKGGCAARRLSW GF SRRCKT AS Sbjct: 34 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 Score = 31.1 bits (67), Expect = 2.4 Identities = 11/14 (78%), Positives = 11/14 (78%) Frame = -2 Query: 1069 HSPFRXRXCWXGRS 1028 HSPFR R CW GRS Sbjct: 19 HSPFRLRNCWEGRS 32 >SB_49895| Best HMM Match : NACHT (HMM E-Value=7.7) Length = 144 Score = 63.3 bits (147), Expect = 5e-10 Identities = 30/37 (81%), Positives = 30/37 (81%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXAS 915 RA SLLRQLAKGGCAARRLSW GF SRRCKT AS Sbjct: 34 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 Score = 31.1 bits (67), Expect = 2.4 Identities = 11/14 (78%), Positives = 11/14 (78%) Frame = -2 Query: 1069 HSPFRXRXCWXGRS 1028 HSPFR R CW GRS Sbjct: 19 HSPFRLRNCWEGRS 32 >SB_49629| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 224 Score = 63.3 bits (147), Expect = 5e-10 Identities = 30/37 (81%), Positives = 30/37 (81%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXAS 915 RA SLLRQLAKGGCAARRLSW GF SRRCKT AS Sbjct: 34 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 Score = 31.1 bits (67), Expect = 2.4 Identities = 11/14 (78%), Positives = 11/14 (78%) Frame = -2 Query: 1069 HSPFRXRXCWXGRS 1028 HSPFR R CW GRS Sbjct: 19 HSPFRLRNCWEGRS 32 >SB_47940| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 85 Score = 63.3 bits (147), Expect = 5e-10 Identities = 30/37 (81%), Positives = 30/37 (81%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXAS 915 RA SLLRQLAKGGCAARRLSW GF SRRCKT AS Sbjct: 12 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_47474| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 63.3 bits (147), Expect = 5e-10 Identities = 30/37 (81%), Positives = 30/37 (81%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXAS 915 RA SLLRQLAKGGCAARRLSW GF SRRCKT AS Sbjct: 12 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_47304| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 63.3 bits (147), Expect = 5e-10 Identities = 30/37 (81%), Positives = 30/37 (81%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXAS 915 RA SLLRQLAKGGCAARRLSW GF SRRCKT AS Sbjct: 12 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_47265| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 63.3 bits (147), Expect = 5e-10 Identities = 30/37 (81%), Positives = 30/37 (81%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXAS 915 RA SLLRQLAKGGCAARRLSW GF SRRCKT AS Sbjct: 12 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_47031| Best HMM Match : Protamine_P1 (HMM E-Value=7) Length = 128 Score = 63.3 bits (147), Expect = 5e-10 Identities = 30/37 (81%), Positives = 30/37 (81%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXAS 915 RA SLLRQLAKGGCAARRLSW GF SRRCKT AS Sbjct: 12 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_46118| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 60 Score = 63.3 bits (147), Expect = 5e-10 Identities = 30/37 (81%), Positives = 30/37 (81%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXAS 915 RA SLLRQLAKGGCAARRLSW GF SRRCKT AS Sbjct: 5 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 41 >SB_45749| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 63.3 bits (147), Expect = 5e-10 Identities = 30/37 (81%), Positives = 30/37 (81%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXAS 915 RA SLLRQLAKGGCAARRLSW GF SRRCKT AS Sbjct: 12 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_45575| Best HMM Match : Keratin_B2 (HMM E-Value=8.8) Length = 271 Score = 63.3 bits (147), Expect = 5e-10 Identities = 30/37 (81%), Positives = 30/37 (81%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXAS 915 RA SLLRQLAKGGCAARRLSW GF SRRCKT AS Sbjct: 12 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_45266| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 63.3 bits (147), Expect = 5e-10 Identities = 30/37 (81%), Positives = 30/37 (81%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXAS 915 RA SLLRQLAKGGCAARRLSW GF SRRCKT AS Sbjct: 12 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_44239| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 82 Score = 63.3 bits (147), Expect = 5e-10 Identities = 30/37 (81%), Positives = 30/37 (81%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXAS 915 RA SLLRQLAKGGCAARRLSW GF SRRCKT AS Sbjct: 12 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_44171| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 83 Score = 63.3 bits (147), Expect = 5e-10 Identities = 30/37 (81%), Positives = 30/37 (81%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXAS 915 RA SLLRQLAKGGCAARRLSW GF SRRCKT AS Sbjct: 12 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_44073| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 63.3 bits (147), Expect = 5e-10 Identities = 30/37 (81%), Positives = 30/37 (81%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXAS 915 RA SLLRQLAKGGCAARRLSW GF SRRCKT AS Sbjct: 12 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_43752| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 78 Score = 63.3 bits (147), Expect = 5e-10 Identities = 30/37 (81%), Positives = 30/37 (81%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXAS 915 RA SLLRQLAKGGCAARRLSW GF SRRCKT AS Sbjct: 12 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_43722| Best HMM Match : TPR_4 (HMM E-Value=0.69) Length = 199 Score = 63.3 bits (147), Expect = 5e-10 Identities = 30/37 (81%), Positives = 30/37 (81%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXAS 915 RA SLLRQLAKGGCAARRLSW GF SRRCKT AS Sbjct: 34 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 Score = 31.1 bits (67), Expect = 2.4 Identities = 11/14 (78%), Positives = 11/14 (78%) Frame = -2 Query: 1069 HSPFRXRXCWXGRS 1028 HSPFR R CW GRS Sbjct: 19 HSPFRLRNCWEGRS 32 >SB_42847| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 60 Score = 63.3 bits (147), Expect = 5e-10 Identities = 30/37 (81%), Positives = 30/37 (81%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXAS 915 RA SLLRQLAKGGCAARRLSW GF SRRCKT AS Sbjct: 5 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 41 >SB_42555| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 63.3 bits (147), Expect = 5e-10 Identities = 30/37 (81%), Positives = 30/37 (81%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXAS 915 RA SLLRQLAKGGCAARRLSW GF SRRCKT AS Sbjct: 12 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_42300| Best HMM Match : Filament_head (HMM E-Value=4.9) Length = 152 Score = 63.3 bits (147), Expect = 5e-10 Identities = 30/37 (81%), Positives = 30/37 (81%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXAS 915 RA SLLRQLAKGGCAARRLSW GF SRRCKT AS Sbjct: 34 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 Score = 31.1 bits (67), Expect = 2.4 Identities = 11/14 (78%), Positives = 11/14 (78%) Frame = -2 Query: 1069 HSPFRXRXCWXGRS 1028 HSPFR R CW GRS Sbjct: 19 HSPFRLRNCWEGRS 32 >SB_42133| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 180 Score = 63.3 bits (147), Expect = 5e-10 Identities = 30/37 (81%), Positives = 30/37 (81%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXAS 915 RA SLLRQLAKGGCAARRLSW GF SRRCKT AS Sbjct: 34 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 Score = 31.1 bits (67), Expect = 2.4 Identities = 11/14 (78%), Positives = 11/14 (78%) Frame = -2 Query: 1069 HSPFRXRXCWXGRS 1028 HSPFR R CW GRS Sbjct: 19 HSPFRLRNCWEGRS 32 >SB_41545| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 101 Score = 63.3 bits (147), Expect = 5e-10 Identities = 30/37 (81%), Positives = 30/37 (81%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXAS 915 RA SLLRQLAKGGCAARRLSW GF SRRCKT AS Sbjct: 12 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_41358| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 63.3 bits (147), Expect = 5e-10 Identities = 30/37 (81%), Positives = 30/37 (81%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXAS 915 RA SLLRQLAKGGCAARRLSW GF SRRCKT AS Sbjct: 34 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 Score = 31.1 bits (67), Expect = 2.4 Identities = 11/14 (78%), Positives = 11/14 (78%) Frame = -2 Query: 1069 HSPFRXRXCWXGRS 1028 HSPFR R CW GRS Sbjct: 19 HSPFRLRNCWEGRS 32 >SB_41085| Best HMM Match : Auxin_repressed (HMM E-Value=9) Length = 206 Score = 63.3 bits (147), Expect = 5e-10 Identities = 30/37 (81%), Positives = 30/37 (81%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXAS 915 RA SLLRQLAKGGCAARRLSW GF SRRCKT AS Sbjct: 34 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 Score = 31.1 bits (67), Expect = 2.4 Identities = 11/14 (78%), Positives = 11/14 (78%) Frame = -2 Query: 1069 HSPFRXRXCWXGRS 1028 HSPFR R CW GRS Sbjct: 19 HSPFRLRNCWEGRS 32 >SB_40884| Best HMM Match : Homeobox (HMM E-Value=0.068) Length = 229 Score = 63.3 bits (147), Expect = 5e-10 Identities = 30/37 (81%), Positives = 30/37 (81%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXAS 915 RA SLLRQLAKGGCAARRLSW GF SRRCKT AS Sbjct: 12 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_40300| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 97 Score = 63.3 bits (147), Expect = 5e-10 Identities = 30/37 (81%), Positives = 30/37 (81%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXAS 915 RA SLLRQLAKGGCAARRLSW GF SRRCKT AS Sbjct: 12 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_39391| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 376 Score = 63.3 bits (147), Expect = 5e-10 Identities = 30/39 (76%), Positives = 30/39 (76%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXASEL 909 R SLLRQL KGGCAARRLSW GF SRRCKT ASEL Sbjct: 338 RTYSLLRQLVKGGCAARRLSWVTPGFSQSRRCKTTASEL 376 >SB_39208| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.3 bits (147), Expect = 5e-10 Identities = 30/37 (81%), Positives = 30/37 (81%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXAS 915 RA SLLRQLAKGGCAARRLSW GF SRRCKT AS Sbjct: 34 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 Score = 31.1 bits (67), Expect = 2.4 Identities = 11/14 (78%), Positives = 11/14 (78%) Frame = -2 Query: 1069 HSPFRXRXCWXGRS 1028 HSPFR R CW GRS Sbjct: 19 HSPFRLRNCWEGRS 32 >SB_38658| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 63.3 bits (147), Expect = 5e-10 Identities = 30/37 (81%), Positives = 30/37 (81%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXAS 915 RA SLLRQLAKGGCAARRLSW GF SRRCKT AS Sbjct: 12 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_38558| Best HMM Match : TFIIA_gamma_N (HMM E-Value=7.4) Length = 164 Score = 63.3 bits (147), Expect = 5e-10 Identities = 30/37 (81%), Positives = 30/37 (81%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXAS 915 RA SLLRQLAKGGCAARRLSW GF SRRCKT AS Sbjct: 34 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 Score = 31.1 bits (67), Expect = 2.4 Identities = 11/14 (78%), Positives = 11/14 (78%) Frame = -2 Query: 1069 HSPFRXRXCWXGRS 1028 HSPFR R CW GRS Sbjct: 19 HSPFRLRNCWEGRS 32 >SB_38521| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 506 Score = 63.3 bits (147), Expect = 5e-10 Identities = 30/37 (81%), Positives = 30/37 (81%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXAS 915 RA SLLRQLAKGGCAARRLSW GF SRRCKT AS Sbjct: 123 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 159 >SB_38282| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 63.3 bits (147), Expect = 5e-10 Identities = 30/37 (81%), Positives = 30/37 (81%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXAS 915 RA SLLRQLAKGGCAARRLSW GF SRRCKT AS Sbjct: 12 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_38080| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 63.3 bits (147), Expect = 5e-10 Identities = 30/37 (81%), Positives = 30/37 (81%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXAS 915 RA SLLRQLAKGGCAARRLSW GF SRRCKT AS Sbjct: 12 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_37703| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 63.3 bits (147), Expect = 5e-10 Identities = 30/37 (81%), Positives = 30/37 (81%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXAS 915 RA SLLRQLAKGGCAARRLSW GF SRRCKT AS Sbjct: 12 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_37072| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 66 Score = 63.3 bits (147), Expect = 5e-10 Identities = 30/37 (81%), Positives = 30/37 (81%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXAS 915 RA SLLRQLAKGGCAARRLSW GF SRRCKT AS Sbjct: 12 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_36830| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 163 Score = 63.3 bits (147), Expect = 5e-10 Identities = 30/37 (81%), Positives = 30/37 (81%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXAS 915 RA SLLRQLAKGGCAARRLSW GF SRRCKT AS Sbjct: 12 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_36723| Best HMM Match : DUF753 (HMM E-Value=9.9) Length = 130 Score = 63.3 bits (147), Expect = 5e-10 Identities = 30/37 (81%), Positives = 30/37 (81%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXAS 915 RA SLLRQLAKGGCAARRLSW GF SRRCKT AS Sbjct: 34 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 Score = 31.1 bits (67), Expect = 2.4 Identities = 11/14 (78%), Positives = 11/14 (78%) Frame = -2 Query: 1069 HSPFRXRXCWXGRS 1028 HSPFR R CW GRS Sbjct: 19 HSPFRLRNCWEGRS 32 >SB_36604| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 63.3 bits (147), Expect = 5e-10 Identities = 30/37 (81%), Positives = 30/37 (81%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXAS 915 RA SLLRQLAKGGCAARRLSW GF SRRCKT AS Sbjct: 12 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_36374| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 67 Score = 63.3 bits (147), Expect = 5e-10 Identities = 30/37 (81%), Positives = 30/37 (81%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXAS 915 RA SLLRQLAKGGCAARRLSW GF SRRCKT AS Sbjct: 12 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_35614| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 67 Score = 63.3 bits (147), Expect = 5e-10 Identities = 30/37 (81%), Positives = 30/37 (81%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXAS 915 RA SLLRQLAKGGCAARRLSW GF SRRCKT AS Sbjct: 12 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_35131| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 63.3 bits (147), Expect = 5e-10 Identities = 30/37 (81%), Positives = 30/37 (81%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXAS 915 RA SLLRQLAKGGCAARRLSW GF SRRCKT AS Sbjct: 12 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_34873| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 63.3 bits (147), Expect = 5e-10 Identities = 30/37 (81%), Positives = 30/37 (81%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXAS 915 RA SLLRQLAKGGCAARRLSW GF SRRCKT AS Sbjct: 12 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_34844| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 63.3 bits (147), Expect = 5e-10 Identities = 30/37 (81%), Positives = 30/37 (81%) Frame = -1 Query: 1025 RAXSLLRQLAKGGCAARRLSW*RQGFPXSRRCKTXAS 915 RA SLLRQLAKGGCAARRLSW GF SRRCKT AS Sbjct: 12 RASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 36,020,799 Number of Sequences: 59808 Number of extensions: 688992 Number of successful extensions: 12312 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 5785 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9889 length of database: 16,821,457 effective HSP length: 85 effective length of database: 11,737,777 effective search space used: 4988555225 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -