BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030725E6_F12_e574_12.seq (1568 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 10_08_0824 + 20821724-20822137,20822457-20822543,20822729-208228... 33 0.62 01_06_0004 + 25507739-25508206,25509346-25509477,25509910-255100... 31 3.3 11_06_0495 - 24319531-24320831,24320923-24321109,24322919-243230... 30 5.7 01_05_0495 + 22705697-22705765,22705903-22706025,22708429-227085... 30 5.7 03_05_0944 + 29046793-29046922,29048091-29048464,29048556-290486... 29 7.6 >10_08_0824 + 20821724-20822137,20822457-20822543,20822729-20822829, 20822917-20822967,20823616-20823790,20823878-20824192, 20824504-20824707,20824799-20825314,20825400-20825609, 20826092-20826280,20827254-20827405,20827685-20827837, 20827925-20828006,20828086-20828475 Length = 1012 Score = 33.1 bits (72), Expect = 0.62 Identities = 25/72 (34%), Positives = 37/72 (51%), Gaps = 1/72 (1%) Frame = +3 Query: 282 FETTQSNEQSYKDLVMPLITQLVDNLKSKQITDIKIYL-AGHTSKYPYPILYDTDLKLKS 458 FET + E S D L+T+++DNL + + Y + TS Y YP L D + L Sbjct: 540 FETKAALENSSSDDDSQLLTRIIDNLVDESHESNQTYSDSNDTSLYNYPSLSDWN-DLNE 598 Query: 459 SKLHFDDKERYE 494 ++ F+D ER E Sbjct: 599 VEI-FEDIERRE 609 >01_06_0004 + 25507739-25508206,25509346-25509477,25509910-25510086, 25510175-25510219,25510305-25510512,25510766-25510825, 25510826-25511016,25511219-25511614 Length = 558 Score = 30.7 bits (66), Expect = 3.3 Identities = 26/88 (29%), Positives = 40/88 (45%), Gaps = 2/88 (2%) Frame = +3 Query: 66 IRHEAVSGTDAAKDLHQACDLARGYAALALTG--LLPAVLPDACVRCTDADKPHAIGDVY 239 +++E + GT K +H AC + + + LTG L P +P R D A G++Y Sbjct: 474 VQYENIRGTFTIKPVHFACSDSSPCSGITLTGVQLRPVQIPH--YRLNDPFCWQAFGELY 531 Query: 240 QLKVPNKQADIVVSFETTQSNEQSYKDL 323 VP + + +N QSY DL Sbjct: 532 TPTVP--PIACLHLGKPAGNNLQSYHDL 557 >11_06_0495 - 24319531-24320831,24320923-24321109,24322919-24323062, 24324467-24324469 Length = 544 Score = 29.9 bits (64), Expect = 5.7 Identities = 16/40 (40%), Positives = 24/40 (60%), Gaps = 2/40 (5%) Frame = +1 Query: 652 NTFS*QCLSLASMSFVLFEFXLAALYSKRLL--ENLGMFD 765 NTF+ C +LASM+ +L + LA + L E+LG+ D Sbjct: 92 NTFAFACATLASMTTILMGYNLALMSGAELFIREDLGLAD 131 >01_05_0495 + 22705697-22705765,22705903-22706025,22708429-22708586, 22709162-22709206,22709367-22709445,22709522-22709595, 22709703-22709809,22711116-22711301,22711882-22711920, 22712020-22712086,22712207-22712281,22713113-22713347, 22713425-22713755,22714530-22714710,22714810-22714950, 22715041-22715302,22715503-22715892,22717179-22717735, 22718421-22718557,22718672-22718853,22718959-22719339, 22719420-22719545,22719635-22719700,22720056-22721839, 22721914-22722193,22722386-22722616,22723067-22723588, 22723683-22723815,22723937-22724193 Length = 2405 Score = 29.9 bits (64), Expect = 5.7 Identities = 27/82 (32%), Positives = 40/82 (48%), Gaps = 8/82 (9%) Frame = +3 Query: 447 KLKSSKLHFDDKERYERM-PFVKTGCDTFDKYEKNVIDFMD---TLKIKLGL----SNIV 602 +LKS KLH +D+E ++ PFVK + ++V+ L IKL L N Sbjct: 1739 RLKSIKLHKNDEELLSKLDPFVKLLAECLSSKHESVLSISFRCLALLIKLPLPSLKDNAN 1798 Query: 603 LSEKSLLDLPFRAGAVKHVLLT 668 L + L+D+ RAG L+T Sbjct: 1799 LIKNVLMDIAQRAGNSNGHLVT 1820 >03_05_0944 + 29046793-29046922,29048091-29048464,29048556-29048687, 29048829-29049210,29049370-29049513,29049593-29049777, 29049925-29050051,29050603-29050676,29051071-29051147, 29051256-29051292,29051453-29051619,29051800-29051983, 29052053-29052130,29052451-29052570,29052648-29052707, 29053057-29053179,29053848-29053941,29054019-29054197, 29054737-29055039,29055373-29055474,29055553-29055693, 29055831-29055995,29056168-29056344,29056432-29056554, 29057787-29057867,29057983-29058099,29058214-29058386, 29058846-29058923,29058994-29059141,29059755-29059877, 29060015-29060071,29060145-29060255,29060382-29060573, 29060690-29060863,29061263-29061373,29061462-29061531, 29061734-29061812,29061898-29062000,29062086-29062256, 29062348-29062470,29062548-29062661,29062935-29063041, 29063117-29063168,29063245-29063351,29063589-29063703, 29063819-29063929,29064016-29064153,29064230-29064352, 29064535-29064606,29064774-29064886,29066780-29067110, 29067199-29067381,29068669-29068863,29068943-29069110, 29069208-29069340,29069511-29069595,29069726-29069765 Length = 2591 Score = 29.5 bits (63), Expect = 7.6 Identities = 17/63 (26%), Positives = 31/63 (49%) Frame = -2 Query: 763 RTYPDFPTNALNTTPPXKIRIRRNSSMQGSDTVKRTCLTAPARNGRSRSDFSLKTILDKP 584 R Y D T++ + P K R +SS+ +T K T TAPA ++ + + +L + Sbjct: 791 RAYDDQDTDSAQSGAPTKSDRRESSSIGKRETGKSTKKTAPADKAKTAKEEARDLLLKEE 850 Query: 583 SFI 575 + + Sbjct: 851 ASV 853 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 26,404,782 Number of Sequences: 37544 Number of extensions: 468607 Number of successful extensions: 1244 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1205 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1244 length of database: 14,793,348 effective HSP length: 85 effective length of database: 11,602,108 effective search space used: 5070121196 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -