BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030725E6_F12_e574_12.seq (1568 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 26 0.77 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 26 0.77 AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein pr... 25 1.3 AF213012-1|AAG43568.1| 492|Apis mellifera acetylcholinesterase ... 25 1.3 AB181702-1|BAE06051.1| 628|Apis mellifera acetylcholinesterase ... 25 1.3 DQ855486-1|ABH88173.1| 104|Apis mellifera chemosensory protein ... 25 2.4 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 25 2.4 AY242387-1|AAO72539.2| 693|Apis mellifera prophenoloxidase prot... 23 5.4 DQ855484-1|ABH88171.1| 130|Apis mellifera chemosensory protein ... 23 7.2 AJ973401-1|CAJ01448.1| 130|Apis mellifera hypothetical protein ... 23 7.2 AF481963-1|AAN59784.1| 130|Apis mellifera antennal-specific pro... 23 7.2 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 26.2 bits (55), Expect = 0.77 Identities = 16/61 (26%), Positives = 31/61 (50%) Frame = +3 Query: 600 VLSEKSLLDLPFRAGAVKHVLLTVSEPCIDEFRLIRILXGGVVFKAFVGKSGYVRLXIVT 779 VL +L+ LPF A A + + + + C+ + R+L V +A V ++ V + ++ Sbjct: 81 VLRNGTLVLLPFPAAAFRQDVHSAAYRCVASNSVGRVLSRDVQVRAVVAQAYKVDVEVIG 140 Query: 780 G 782 G Sbjct: 141 G 141 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 26.2 bits (55), Expect = 0.77 Identities = 16/61 (26%), Positives = 31/61 (50%) Frame = +3 Query: 600 VLSEKSLLDLPFRAGAVKHVLLTVSEPCIDEFRLIRILXGGVVFKAFVGKSGYVRLXIVT 779 VL +L+ LPF A A + + + + C+ + R+L V +A V ++ V + ++ Sbjct: 81 VLRNGTLVLLPFPAAAFRQDVHSAAYRCVASNSVGRVLSRDVQVRAVVAQAYKVDVEVIG 140 Query: 780 G 782 G Sbjct: 141 G 141 >AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein protein. Length = 1308 Score = 25.4 bits (53), Expect = 1.3 Identities = 32/119 (26%), Positives = 47/119 (39%), Gaps = 2/119 (1%) Frame = +3 Query: 54 GLQXIRHEAVSGTDAAKDLHQACDLARGYAALA--LTGLLPAVLPDACVRCTDADKPHAI 227 GLQ IR +SG LH A + A+ +T L +LP V+ + Sbjct: 930 GLQTIR---LSGHSV---LHSAQSVVASSASNVTNVTTNLTTILPPVKVQSQQQSQQSQQ 983 Query: 228 GDVYQLKVPNKQADIVVSFETTQSNEQSYKDLVMPLITQLVDNLKSKQITDIKIYLAGH 404 Q V N+ ++ +T +QS + V+P T L +K IK L GH Sbjct: 984 QQQQQTIVTNQAGKSIL--QTANIKQQSPQQHVLPGKTLLASQIKLVSPGQIKSLLTGH 1040 >AF213012-1|AAG43568.1| 492|Apis mellifera acetylcholinesterase protein. Length = 492 Score = 25.4 bits (53), Expect = 1.3 Identities = 16/74 (21%), Positives = 33/74 (44%) Frame = +3 Query: 348 VDNLKSKQITDIKIYLAGHTSKYPYPILYDTDLKLKSSKLHFDDKERYERMPFVKTGCDT 527 +D L+ D +I + + ++ Y ILYD + + + F ++ER+ + + Sbjct: 361 LDLLREADFKDTEILIGNNENEGTYFILYDFNDIFEKDQASFLERERF--LGIINNIFKN 418 Query: 528 FDKYEKNVIDFMDT 569 + E+ I F T Sbjct: 419 MSQIEREAITFQYT 432 >AB181702-1|BAE06051.1| 628|Apis mellifera acetylcholinesterase protein. Length = 628 Score = 25.4 bits (53), Expect = 1.3 Identities = 16/74 (21%), Positives = 33/74 (44%) Frame = +3 Query: 348 VDNLKSKQITDIKIYLAGHTSKYPYPILYDTDLKLKSSKLHFDDKERYERMPFVKTGCDT 527 +D L+ D +I + + ++ Y ILYD + + + F ++ER+ + + Sbjct: 361 LDLLREADFKDTEILIGNNENEGTYFILYDFNDIFEKDQASFLERERF--LGIINNIFKN 418 Query: 528 FDKYEKNVIDFMDT 569 + E+ I F T Sbjct: 419 MSQIEREAITFQYT 432 >DQ855486-1|ABH88173.1| 104|Apis mellifera chemosensory protein 5 protein. Length = 104 Score = 24.6 bits (51), Expect = 2.4 Identities = 16/37 (43%), Positives = 20/37 (54%), Gaps = 3/37 (8%) Frame = +3 Query: 102 KDLHQACDLARGYAALA---LTGLLPAVLPDACVRCT 203 K LH C L RG+ + + LLP VL + C RCT Sbjct: 35 KQLH--CILDRGHCDVIGKKIKELLPEVLNNHCNRCT 69 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 24.6 bits (51), Expect = 2.4 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +3 Query: 114 QACDLARGYAALALTGLLPAVLPDACV 194 Q +A A ALTG P +LP C+ Sbjct: 463 QVDPMAASVVAAALTGTYPTLLPQWCL 489 >AY242387-1|AAO72539.2| 693|Apis mellifera prophenoloxidase protein. Length = 693 Score = 23.4 bits (48), Expect = 5.4 Identities = 11/19 (57%), Positives = 13/19 (68%) Frame = +1 Query: 394 SRDTHLNIPTLSYTILI*N 450 +R THLN SYTI+I N Sbjct: 473 ARFTHLNHADFSYTIVINN 491 >DQ855484-1|ABH88171.1| 130|Apis mellifera chemosensory protein 3 protein. Length = 130 Score = 23.0 bits (47), Expect = 7.2 Identities = 13/36 (36%), Positives = 17/36 (47%) Frame = +3 Query: 153 LTGLLPAVLPDACVRCTDADKPHAIGDVYQLKVPNK 260 L +LP L C +CTD + I V + V NK Sbjct: 64 LKRVLPDALATDCKKCTDKQR-EVIKKVIKFLVENK 98 >AJ973401-1|CAJ01448.1| 130|Apis mellifera hypothetical protein protein. Length = 130 Score = 23.0 bits (47), Expect = 7.2 Identities = 13/36 (36%), Positives = 17/36 (47%) Frame = +3 Query: 153 LTGLLPAVLPDACVRCTDADKPHAIGDVYQLKVPNK 260 L +LP L C +CTD + I V + V NK Sbjct: 64 LKRVLPDALATDCKKCTDKQR-EVIKKVIKFLVENK 98 >AF481963-1|AAN59784.1| 130|Apis mellifera antennal-specific protein 3c precursor protein. Length = 130 Score = 23.0 bits (47), Expect = 7.2 Identities = 13/36 (36%), Positives = 17/36 (47%) Frame = +3 Query: 153 LTGLLPAVLPDACVRCTDADKPHAIGDVYQLKVPNK 260 L +LP L C +CTD + I V + V NK Sbjct: 64 LKRVLPDALATDCKKCTDKQR-EVIKKVIKFLVENK 98 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 267,832 Number of Sequences: 438 Number of extensions: 5290 Number of successful extensions: 19 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 18 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 19 length of database: 146,343 effective HSP length: 61 effective length of database: 119,625 effective search space used: 55147125 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -