BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030725E6_F10_e558_12.seq (1539 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF003151-12|AAK18912.1| 149|Caenorhabditis elegans Ribosomal pr... 72 1e-12 >AF003151-12|AAK18912.1| 149|Caenorhabditis elegans Ribosomal protein, small subunitprotein 10 protein. Length = 149 Score = 71.7 bits (168), Expect = 1e-12 Identities = 44/105 (41%), Positives = 55/105 (52%) Frame = +3 Query: 96 DMLRNSSHGRHFYWYLTNEGIEYLRIFLHLPPEIVPATLKRSVRTETVRRGAVGRPDAPA 275 ++++ RH+YWYLT+ GI YLR +L LP EIVPAT+K R V P A Sbjct: 54 ELVKEQFAWRHYYWYLTDAGILYLREYLALPAEIVPATIKTKPREIRVPH-EDRAPRAAQ 112 Query: 276 RTAEDRSAYRRAPPAGAPHDKKADVGPGSADVEFRGGFGRGRSAP 410 DR AYR +K + GPG A V +R GFGRG P Sbjct: 113 GEKGDREAYRT--------EKVTEAGPGGAPV-YRAGFGRGAPPP 148 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 26,146,544 Number of Sequences: 27780 Number of extensions: 510468 Number of successful extensions: 1210 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1122 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1207 length of database: 12,740,198 effective HSP length: 85 effective length of database: 10,378,898 effective search space used: 4431789446 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -