Samia BLAST Result against fruitfly

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 030725E6_F08_e542_12.seq
         (1593 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AE014298-1773|AAF48168.2|  816|Drosophila melanogaster CG2559-PA...    33   1.4  

>AE014298-1773|AAF48168.2|  816|Drosophila melanogaster CG2559-PA
           protein.
          Length = 816

 Score = 32.7 bits (71), Expect = 1.4
 Identities = 21/67 (31%), Positives = 36/67 (53%)
 Frame = +2

Query: 584 LIGIVKTNGSDVLYVLTENHDVYKVSDGGNKNEKLEDVKDAQEIVLDYSNNLYFYGKDKA 763
           L+G+ +   S+  Y+L EN  +Y+ +   N    ++DVK    + +DYS +LY Y ++  
Sbjct: 257 LMGLGEHWYSESNYILREN--IYEYNQESNWLTMMKDVKKFY-MPVDYSRDLYLYNEESK 313

Query: 764 PYVVTED 784
               TED
Sbjct: 314 LSYFTED 320


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 54,875,771
Number of Sequences: 53049
Number of extensions: 1037488
Number of successful extensions: 2020
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1887
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2016
length of database: 24,988,368
effective HSP length: 88
effective length of database: 20,320,056
effective search space used: 8981464752
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)