BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030725E6_F02_e494_12.seq (1578 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_50682| Best HMM Match : CSD (HMM E-Value=2.1e-38) 54 2e-07 SB_30241| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 0.001 >SB_50682| Best HMM Match : CSD (HMM E-Value=2.1e-38) Length = 80 Score = 54.4 bits (125), Expect = 2e-07 Identities = 28/71 (39%), Positives = 42/71 (59%) Frame = +3 Query: 258 IAEKVSGTVKWFNXKSGYGFINRNDTKEDVFVHQTAIIRNNPRKAVRSVGDGEAVEFAVV 437 ++ + +GTVKWFN + GYGFI + +D+FVH AI +S+ +G+AV F Sbjct: 12 MSNRQNGTVKWFNDEKGYGFIT-PQSGDDLFVHFKAI----QSDGFKSLKEGQAVTFVAT 66 Query: 438 AGEKGYEAARV 470 G+KG +A V Sbjct: 67 RGQKGMQAEEV 77 >SB_30241| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 214 Score = 42.3 bits (95), Expect = 0.001 Identities = 19/34 (55%), Positives = 24/34 (70%) Frame = +3 Query: 447 KGYEAARVTGPGGESVKGSPYAADKRRSYHRQYY 548 +G EA+ VTGP GE V+GS YA D+RR +R Y Sbjct: 13 QGLEASNVTGPDGEPVQGSKYAPDRRRRNNRYDY 46 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 23,613,995 Number of Sequences: 59808 Number of extensions: 345379 Number of successful extensions: 774 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 723 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 773 length of database: 16,821,457 effective HSP length: 85 effective length of database: 11,737,777 effective search space used: 5164621880 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -