BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030725E6_E11_e565_09.seq (1558 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY127579-1|AAN02286.1| 405|Apis mellifera venom protease precur... 25 1.8 AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 24 3.1 >AY127579-1|AAN02286.1| 405|Apis mellifera venom protease precursor protein. Length = 405 Score = 25.0 bits (52), Expect = 1.8 Identities = 13/38 (34%), Positives = 19/38 (50%) Frame = +1 Query: 520 GKRDLWLVSS*CRI*LWDQLALLKLRQNCTVESLSIKK 633 G + W ++S RI L L +NC SL++KK Sbjct: 67 GSKCTWTITSYHRINLKCSLVEFSENKNCNAGSLTVKK 104 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 24.2 bits (50), Expect = 3.1 Identities = 11/23 (47%), Positives = 14/23 (60%) Frame = -1 Query: 802 FPFTPTKASGSASRIDTY*VLLS 734 FP P AS + S++D Y LLS Sbjct: 653 FPLPPNLASANISQLDPYSSLLS 675 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 316,411 Number of Sequences: 438 Number of extensions: 7065 Number of successful extensions: 16 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16 length of database: 146,343 effective HSP length: 61 effective length of database: 119,625 effective search space used: 54668625 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -