BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= 030725E6_E09_e549_09.seq (1522 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC14C4.02c |smc5|spr18|Smc5-6 complex SMC subunit Smc5 |Schizo... 27 5.2 SPCC553.01c ||SPCC736.01c|meiotic chromosome segregation protein... 27 9.0 >SPAC14C4.02c |smc5|spr18|Smc5-6 complex SMC subunit Smc5 |Schizosaccharomyces pombe|chr 1|||Manual Length = 1065 Score = 27.5 bits (58), Expect = 5.2 Identities = 14/42 (33%), Positives = 22/42 (52%) Frame = +2 Query: 218 KALVLEDKSGTIIELKDNGQVTLNGAAHGFPVIEKDVFAFKQ 343 K + L + I++ K+ GQ TLN +EK+V FK+ Sbjct: 174 KLIDLRKREREILQNKNQGQSTLNSLKDRQQALEKEVNIFKE 215 >SPCC553.01c ||SPCC736.01c|meiotic chromosome segregation protein|Schizosaccharomyces pombe|chr 3|||Manual Length = 715 Score = 26.6 bits (56), Expect = 9.0 Identities = 15/30 (50%), Positives = 18/30 (60%), Gaps = 1/30 (3%) Frame = +2 Query: 452 RGLLGDGNNEPYDDFRLPNGKI-CTSESEF 538 RG+L D +N DDF L N +I SE EF Sbjct: 38 RGILYDSDNRVVDDFFLNNKRIVLDSEIEF 67 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,983,125 Number of Sequences: 5004 Number of extensions: 70678 Number of successful extensions: 159 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 154 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 159 length of database: 2,362,478 effective HSP length: 76 effective length of database: 1,982,174 effective search space used: 852334820 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -