Samia BLAST Result against arabidopsis

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= 030725E6_E09_e549_09.seq
         (1522 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At1g33811.1 68414.m04180 GDSL-motif lipase/hydrolase family prot...    29   8.1  

>At1g33811.1 68414.m04180 GDSL-motif lipase/hydrolase family protein
           similar to family II lipases EXL3 GI:15054386, EXL1
           GI:15054382, EXL2 GI:15054384 from [Arabidopsis
           thaliana]; contains Pfam profile PF00657: GDSL-like
           Lipase/Acylhydrolase
          Length = 370

 Score = 29.1 bits (62), Expect = 8.1
 Identities = 12/32 (37%), Positives = 19/32 (59%)
 Frame = +2

Query: 263 KDNGQVTLNGAAHGFPVIEKDVFAFKQTNGRI 358
           K    + +NGAA+GF V++K      + NG+I
Sbjct: 286 KSTYDLAVNGAAYGFEVVDKGCCGVGRNNGQI 317


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 21,832,985
Number of Sequences: 28952
Number of extensions: 404828
Number of successful extensions: 957
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 938
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 957
length of database: 12,070,560
effective HSP length: 84
effective length of database: 9,638,592
effective search space used: 4067485824
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)